KEGG   Gallibacterium anatis: UMN179_00044Help
Entry
UMN179_00044      CDS       T01482                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
gan  Gallibacterium anatis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:gan00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(47137..51678)
Genome map
AA seq 1513 aa AA seqDB search
MDSSISCSSNGHISLRSQLEQQAYAVGVSPFYYTLEGQKIDVDDSVLTQLISWLQPEQNS
AENYKNAFVLNAETVERLTWQTLDFADDEMPQQLLNEKNQIIENGWHLQSGEYIEFIPLT
MGYYCLITNYARYCLLVAPAKTYQPPLLNNDNKVSGLNVQLYSLRSPRNWGIGDLADLES
IALEYAKDGIDFIGINPLHALFPAHPEWASPYSPSSRRWLNPIYLAVDLLPEATSSTFIS
WFNEDAVQQQLAQLQDCAWVDYSGVWQLKLAALRVAYQAFKREGQFAARRQAFSQFVAQQ
GEPLYLHGLFETLDRAFSQQQKEEDDDQLLGWFAWDKAYQNPNSEAVKQFAAEHQTQIEF
YMWLQWLMHDQLSAVRESVAQSGVKLGLYGDLAVGVARGGSDTWCDRQLFCLQASVGAPP
DELGPAGQNWQLPPLQPQQLRAQGYQPLIKLWRANMQNYGILRIDHVMALYRLWWITSGK
NAANGAYVHYPINEMMAVLAIESQRCHCLIVGEDLGIVPPEVRQWLDRYGVYSYAVIYFN
RSYDGYLLPEQYKKNALAVVSTHDLAPLSGFWQATDIETMYQLGVLQQDKYEKALQQRSE
DKLRFIQTLKQAKLLSEMPHDFALTDELKLAIHQLGAVSQSQLFALQPENLLGITSSFNI
PGVAKAYPNWRYRLPHSLLDSQITLQLHRDLRQIIAARQTLPTEVAAECYQDNLKLILLG
KNSMVTFDYNQIEQLFNAVHADPFSFLGPHMTEQGLIIRALLPNAKQVEIYNRDRNHCLA
TMKAVDERGFFVALLPHSEVNLHYVFKIQYENSAEAIYQEDPYRFPSCLFELDNWLLKEG
THHRPYEAMGAHLTENSYVAGVNFSVWAPNARRVSVVGDFNQWDGRRHVMRFHQESGIWE
IFIPEVNEGSLYKFEILDANGDLRLKSDPYAFAAQLRPETASVVTKLPPKQPYNAERAKA
NAIDAPISIYEVHLGSWRRNLENNYWLSYEQIADELIAYVKEMGFTHIELLPLSEFPFDG
SWGYQPLGLYAPTSRFGDAKGLCHFLEKAHEAGIYVLLDWVVGHFPTDDYGLRKFDGTAL
YEHADPREGYHQDWNTLIYNFGRNEVRNYLTGNALYWVERYGFDGLRVDAVASMIYRDYS
RANGEWIPNQYGGRENLEAINFLQRTNALLQDEQRGVLAIAEESTAFPGVSHDTKSGGLG
FQFKWNMGWMNDTLRYMKLDPIYRKYHHNLLTFGMMYQYSEHFVLPLSHDEVVHGKGSLL
SKMPGDCWKQFANLRVYYGYMWGFPGKKLLFMGNEFAQGREWNYQESLDWFLLNEEYGGW
HNGVQKWVRDLNHLYQRHPALWQQDQHPNGFEWLVVDDAEQSVLVFARYAKNGDTIVVVC
NFTPEVRHNYRFGVRKAGFYREVLNSDDVSYKGSGVNNGEGVWSEKIESHGKANSISIDV
PPLGASYFVLENAEDDETDDAELAEATKAEQAVTVATKGKETLSDTNNSKVSKTASKRKP
AKKVKSVKRKTSK
NT seq 4542 nt NT seq  +upstreamnt  +downstreamnt
atggactcgtcgatttcttgctcctctaatggacacatttcactaagatctcaactggaa
cagcaggcttatgctgttggtgtttcgcctttttattacacattggaagggcagaaaatt
gatgttgatgattctgtcttaacgcaattaatttcgtggttgcagcctgaacagaacagt
gcggaaaattataagaatgcctttgttttaaatgcggaaacggtagaacgattaacgtgg
caaacacttgattttgccgatgatgaaatgccgcaacagcttttaaatgaaaaaaatcaa
attattgaaaacggctggcatttgcaaagcggagaatatattgaatttataccgctaaca
atgggttattactgtttgataacaaattatgctcgatactgtctgttggtcgcgccggca
aaaacttatcagccgcctttgttgaataatgataataaagtcagtgggttaaatgttcaa
ttatatagtttgcgttcaccgcgtaattggggcattggagatttagctgatttagagtcg
attgctttggaatatgccaaagacggtattgattttatcggtatcaatccattgcacgca
ctgttcccggcacatcctgaatgggcaagcccttatagcccatcctctcgccggtggttg
aatccgatttatttagcggtcgatttgttacctgaagccacttcaagcacatttatttct
tggtttaatgaggatgctgttcaacaacaattagcccaattacaggattgtgcgtgggta
gattattccggtgtttggcagttgaaattggcagctttgcgtgttgcctatcaagcattt
aaacgcgaagggcagtttgcggcacgtcgtcaagcattttcgcagtttgttgcgcaacag
ggcgaaccgctatatttgcacggtctttttgaaacgttggatcgcgcgttttctcaacag
caaaaagaggaagatgatgatcaacttttaggttggtttgcttgggataaagcttatcaa
aatccgaacagtgaagcagtgaagcagttcgccgcagagcatcaaacacagattgaattt
tatatgtggttacagtggctaatgcacgatcagctttcagccgtgcgggaatcagtagcg
caatccggtgtcaaattggggctttatggtgatctggctgttggtgtagctcgtggcggt
tcggacacttggtgtgatcgccaattattctgcttgcaggcttctgtcggtgcaccgccg
gatgaactcggcccggcagggcagaactggcaattaccgccgctgcaaccacagcaatta
cgggcgcaaggttatcaacccttgattaaattgtggcgagccaatatgcagaattatggt
attttgcgtattgatcacgtgatggcgttataccgtctatggtggattacttcaggcaaa
aatgcagcaaacggtgcatatgtgcattatcctatcaatgaaatgatggccgtgttggcg
attgaaagtcagcgttgccactgtttgattgtcggtgaagatttggggattgtgccaccg
gaagtgcgtcaatggttagaccgttatggcgtttattcctatgcggtgatctattttaat
cggagttatgatggctatttgttgccggagcaatataagaaaaatgcgttagcggtggtc
agcactcacgatttagcgccattgagcggtttttggcaagcgaccgacattgaaacaatg
tatcagctcggcgtgttgcaacaggataaatatgaaaaagcattgcaacaacgcagcgaa
gataaattgcgttttatccaaactttaaaacaggcaaaactgttgtccgaaatgccacat
gattttgctttgacagatgaattgaaactggcaattcatcagttaggggcagtcagtcaa
agtcaattattcgctttacagccggaaaatttattaggcattacttcatcatttaatatt
cccggcgttgcgaaagcgtatccgaattggcgttatcgtctgccacattcactactcgat
tcacaaattactcttcagttacatcgggatttacgtcaaattattgctgcaagacaaaca
ttgccgacagaagtggcggcggaatgttatcaagataatcttaaacttattttattaggg
aaaaatagtatggttaccttcgattataaccaaatcgaacagttatttaatgcagttcac
gctgatccgttctctttcttaggcccacatatgacagagcaagggctgattattcgtgcc
ttattgccgaatgcaaaacaggtagaaatttataatcgtgatagaaatcattgtttagcc
acaatgaaagctgtcgatgaacgtggattttttgtagcattattgccacattctgaggtc
aatctgcattatgtatttaaaattcaatatgaaaacagtgcagaagcgatctatcaggaa
gatccttatcgtttcccatcttgcctgtttgaactggataattggctgttaaaagaggga
acgcatcatcgtccgtatgaagcgatgggcgcacatttaacagaaaacagctatgttgcg
ggcgtaaatttcagtgtttgggcgccaaatgctcgccgagtttctgtggtcggtgatttt
aaccaatgggatggtcgtcgtcacgtgatgcgttttcaccaagagagcggtatttgggaa
atttttattcctgaagtgaatgaaggcagcttgtataaatttgaaattttggatgccaac
ggtgatttacgtttgaaatcagacccttatgcttttgctgcgcaattacgcccggaaacc
gcttctgttgtcacaaaattgccacctaaacaaccgtataatgcagaacgagcgaaagcg
aatgcgattgatgcgccgatcagtatttatgaagtgcatttgggctcttggcggcgcaat
ttagaaaataattattggctaagttatgagcaaattgcggatgagttgatcgcttatgtc
aaagagatgggcttcacccatattgaattattgccgttatcagaatttccgtttgacggt
tcgtggggttatcagccattgggattatatgcgccgaccagtcgttttggtgatgcgaaa
ggcttgtgtcatttcctcgaaaaagcacacgaagccggcatttatgtgctgttggattgg
gtggttggtcatttcccgacagatgattacggcttacgtaaattcgatggtacagcacta
tatgaacacgccgatccgcgtgaaggttatcatcaggattggaataccttgatttacaac
tttggacgcaatgaagtgcgtaactatttgaccggtaatgctttgtattgggtggaacgc
tatggctttgatggtttgcgggttgatgcggtggcctcaatgatttatcgagattatagc
cgcgcaaatggtgaatggattccaaatcaatatggcggacgtgaaaatttggaagcgatc
aatttcttacagcgcaccaatgcgttattgcaggatgaacagcgcggtgtattggcaatt
gcggaagagagtaccgcattcccgggtgttagtcacgatactaaaagtggcggtttaggt
ttccaatttaagtggaatatgggctggatgaatgacaccttgcgctatatgaaattagat
ccgatttatcgtaagtatcaccataatttattgacattcggaatgatgtatcaatacagc
gaacattttgtattgccattatcgcacgatgaggtggttcacggtaaaggctctttatta
agcaaaatgccgggagattgttggaaacaatttgctaatttacgtgtttattacggttat
atgtggggtttcccgggtaaaaaattgctgtttatgggtaatgaatttgcgcaaggcaga
gaatggaattaccaggaaagtttggattggttcttactcaatgaagagtatggcggttgg
cataatggtgttcaaaaatgggtacgcgatttgaatcatctttatcagcgtcatccggca
ttgtggcagcaagatcaacatcctaatggctttgagtggttggtggtggatgatgcagaa
caatctgttttggtgttcgcacgttacgcgaaaaacggcgataccattgttgttgtgtgt
aattttacgccggaagtgcgtcacaattaccgcttcggtgtgcgtaaagccggattttat
cgtgaagtgctgaattctgatgatgtgtcttataaaggtagcggcgtgaataacggtgaa
ggtgtctggagtgaaaaaatcgaaagccacggcaaggctaactcaatcagcattgatgtg
ccgccactaggtgcaagctattttgtgttggaaaatgcagaggacgatgaaactgatgat
gcggaactggcagaagcaacaaaagcagagcaagcggttaccgtagcaaccaaaggaaaa
gaaaccctttcagatacgaataacagcaaagtgagcaaaacggcttccaaaagaaaaccg
gctaaaaaagtaaaatcagtgaaacgaaaaaccagtaaataa

DBGET integrated database retrieval system