KEGG   Gallibacterium anatis: UMN179_00052Help
Entry
UMN179_00052      CDS       T01482                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gan  Gallibacterium anatis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UMN179_00052
Enzymes [BR:gan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     UMN179_00052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(58378..60339)
Genome map
AA seq 653 aa AA seqDB search
MLALLQQLRDQKLIENIDYYFADYIARQGQSQTEAINDLAALFAALLSFANQQGHSCLFL
TKNVLENPFELKYQPEQQALLQQIEDLLAPYDVKALLANLVQHPAFSMNDQQNTPIVCKK
IGEIDALYFHRIWQDEHYIAARLSESRPIHYQQNELTDLKQILQALFPHSQHLPDWQKIA
VATAFSSTISFISGGPGTGKTTTVAKLLLGLQWLQQIRKQPWLNIRLAAPTGKAATRLTE
SLHQAIQNIHLPLDLSSTLPQEAATIHRLLGMRPNSLPRYHQQQPLNIDVLVIDEASMIN
LALMATLLRGIKPSTKLIFLGDKDQLASVESGAIMAELGQFLSFDYSRQQAAFLATVCEQ
QLAFSNELNFIRDSLCHLQHSYRFNQNTGIGQLAKAVNQRQAEESWQLFAEYNDIRVLPL
FRQGEASNQQVVDFAVQLYSDYFQFVQSENNWQPAEIAKAFMLFKQARLLSALRNGQFGV
EQLNQRIAEQLRRKKYIRFQHTHEWYLGKPVIILQNDNNSRLFNGDIGLVLPDKNGDLKV
WFEAEQGFREVLSSRVPSVEPAYVMTVHKSQGSEFTRTVLVLPAEYNPLLSKELIYTAIT
RAKQTFTVFSREAIWKAAVRTQTQRYSGLAQQIKQIFKEKESEDVIKGNSGIE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgttggcattattacaacaattacgcgatcaaaaattgattgaaaatattgattactat
tttgccgattacatcgcacggcaagggcagtcgcaaacagaagcgattaacgatctggca
gcattgtttgccgcattattgagttttgccaatcagcaaggacatagctgcctgtttttg
acaaaaaacgtattagaaaatccgttcgagttgaaatatcagccggaacagcaggcatta
ttgcaacaaattgaggatctgcttgcgccttatgatgtgaaagcattattggcaaattta
gtacaacatccggcattttcgatgaatgatcaacaaaatacaccgattgtgtgcaaaaaa
ataggtgaaattgatgcactctattttcatcggatttggcaagatgaacattatattgcg
gcgcgcctaagtgaaagtcgcccaattcattatcagcagaatgagctgacggatttgaaa
caaattttgcaagcattattcccacattctcagcacttaccggattggcagaaaatagcg
gtagcgacggcattttcatcaacaatcagctttatttccggtggaccgggtacagggaaa
acgacaacagttgctaaattattgcttggcttgcaatggttgcaacagatacgcaagcaa
ccttggctcaatattcgattagccgcaccgaccggaaaagcagcgacacgattgacggaa
tcattgcatcaagccattcaaaatattcatttgccacttgatttatcatcaacgttgcca
caggaagccgcaaccattcaccgtttattggggatgcgtcccaacagcctgccacgttat
catcagcaacagccgctcaatattgatgtgttggtgattgatgaagcctcaatgattaat
ttagcgttgatggcaacactgttgcgtggcataaaaccgagtacgaaattgatcttttta
ggtgataaagatcaattggcttcggtggaaagtggcgcaattatggcggaattggggcaa
tttttatcgtttgattacagccggcaacaagcggcttttttagcaacagtttgtgaacag
cagcttgcatttagtaatgaactgaattttattcgtgatagcctttgtcatctgcaacac
agctatcgttttaatcaaaataccggaattgggcagttggcaaaagcggttaatcaacgt
caagctgaagaaagctggcaactttttgctgaatataacgatattcgtgtgctgccgtta
tttcgacaaggtgaagcaagcaatcaacaggtggtggattttgcagttcaactttattcc
gattattttcaatttgtacaaagtgaaaataattggcagccggcagagattgcaaaggcg
tttatgttatttaaacaagcacgtttgttaagtgcattgcgtaacgggcaattcggtgtg
gagcagttaaatcaacgcattgcagaacagttacggcgtaagaaatatatccgttttcaa
cacacacacgaatggtatctcggcaagccggtgattattttacaaaatgataacaacagc
cgcttgtttaatggtgatataggtttagtattacctgataaaaacggtgatttaaaagtt
tggtttgaggcagaacaaggttttcgtgaagtgttatcaagccgtgtgccgagtgttgaa
ccggcttatgtgatgactgtgcataaatcgcaaggttctgaatttacccgcaccgtgctg
gtattgccggcggagtataatccactgttgagcaaagagcttatctatactgccattacc
cgtgcaaaacagacgtttacggtatttagtcgggaagcgatttggaaagcggcagtgcga
acacaaacccagcgttacagcggtttggcacaacaaatcaaacagatttttaaggaaaag
gagtcagaggatgttattaaaggcaattccggcattgagtga

DBGET integrated database retrieval system