KEGG   Gallibacterium anatis: UMN179_00052Help
Entry
UMN179_00052      CDS       T01482                                 

Definition
(GenBank) exonuclease V alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
gan  Gallibacterium anatis
Pathway
gan03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UMN179_00052
Enzymes [BR:gan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     UMN179_00052
DNA repair and recombination proteins [BR:gan03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     UMN179_00052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Helicase_RecD AAA_11 Viral_helicase1 AAA_22 DUF2075 PhoH UvrD-helicase UvrD_C AAA_28 AAA_16 AAA NTPase_1
Motif
Other DBs
NCBI-ProteinID: AEC16089
UniProt: F4HA57
Position
complement(58378..60339)
Genome map
AA seq 653 aa AA seqDB search
MLALLQQLRDQKLIENIDYYFADYIARQGQSQTEAINDLAALFAALLSFANQQGHSCLFL
TKNVLENPFELKYQPEQQALLQQIEDLLAPYDVKALLANLVQHPAFSMNDQQNTPIVCKK
IGEIDALYFHRIWQDEHYIAARLSESRPIHYQQNELTDLKQILQALFPHSQHLPDWQKIA
VATAFSSTISFISGGPGTGKTTTVAKLLLGLQWLQQIRKQPWLNIRLAAPTGKAATRLTE
SLHQAIQNIHLPLDLSSTLPQEAATIHRLLGMRPNSLPRYHQQQPLNIDVLVIDEASMIN
LALMATLLRGIKPSTKLIFLGDKDQLASVESGAIMAELGQFLSFDYSRQQAAFLATVCEQ
QLAFSNELNFIRDSLCHLQHSYRFNQNTGIGQLAKAVNQRQAEESWQLFAEYNDIRVLPL
FRQGEASNQQVVDFAVQLYSDYFQFVQSENNWQPAEIAKAFMLFKQARLLSALRNGQFGV
EQLNQRIAEQLRRKKYIRFQHTHEWYLGKPVIILQNDNNSRLFNGDIGLVLPDKNGDLKV
WFEAEQGFREVLSSRVPSVEPAYVMTVHKSQGSEFTRTVLVLPAEYNPLLSKELIYTAIT
RAKQTFTVFSREAIWKAAVRTQTQRYSGLAQQIKQIFKEKESEDVIKGNSGIE
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgttggcattattacaacaattacgcgatcaaaaattgattgaaaatattgattactat
tttgccgattacatcgcacggcaagggcagtcgcaaacagaagcgattaacgatctggca
gcattgtttgccgcattattgagttttgccaatcagcaaggacatagctgcctgtttttg
acaaaaaacgtattagaaaatccgttcgagttgaaatatcagccggaacagcaggcatta
ttgcaacaaattgaggatctgcttgcgccttatgatgtgaaagcattattggcaaattta
gtacaacatccggcattttcgatgaatgatcaacaaaatacaccgattgtgtgcaaaaaa
ataggtgaaattgatgcactctattttcatcggatttggcaagatgaacattatattgcg
gcgcgcctaagtgaaagtcgcccaattcattatcagcagaatgagctgacggatttgaaa
caaattttgcaagcattattcccacattctcagcacttaccggattggcagaaaatagcg
gtagcgacggcattttcatcaacaatcagctttatttccggtggaccgggtacagggaaa
acgacaacagttgctaaattattgcttggcttgcaatggttgcaacagatacgcaagcaa
ccttggctcaatattcgattagccgcaccgaccggaaaagcagcgacacgattgacggaa
tcattgcatcaagccattcaaaatattcatttgccacttgatttatcatcaacgttgcca
caggaagccgcaaccattcaccgtttattggggatgcgtcccaacagcctgccacgttat
catcagcaacagccgctcaatattgatgtgttggtgattgatgaagcctcaatgattaat
ttagcgttgatggcaacactgttgcgtggcataaaaccgagtacgaaattgatcttttta
ggtgataaagatcaattggcttcggtggaaagtggcgcaattatggcggaattggggcaa
tttttatcgtttgattacagccggcaacaagcggcttttttagcaacagtttgtgaacag
cagcttgcatttagtaatgaactgaattttattcgtgatagcctttgtcatctgcaacac
agctatcgttttaatcaaaataccggaattgggcagttggcaaaagcggttaatcaacgt
caagctgaagaaagctggcaactttttgctgaatataacgatattcgtgtgctgccgtta
tttcgacaaggtgaagcaagcaatcaacaggtggtggattttgcagttcaactttattcc
gattattttcaatttgtacaaagtgaaaataattggcagccggcagagattgcaaaggcg
tttatgttatttaaacaagcacgtttgttaagtgcattgcgtaacgggcaattcggtgtg
gagcagttaaatcaacgcattgcagaacagttacggcgtaagaaatatatccgttttcaa
cacacacacgaatggtatctcggcaagccggtgattattttacaaaatgataacaacagc
cgcttgtttaatggtgatataggtttagtattacctgataaaaacggtgatttaaaagtt
tggtttgaggcagaacaaggttttcgtgaagtgttatcaagccgtgtgccgagtgttgaa
ccggcttatgtgatgactgtgcataaatcgcaaggttctgaatttacccgcaccgtgctg
gtattgccggcggagtataatccactgttgagcaaagagcttatctatactgccattacc
cgtgcaaaacagacgtttacggtatttagtcgggaagcgatttggaaagcggcagtgcga
acacaaacccagcgttacagcggtttggcacaacaaatcaaacagatttttaaggaaaag
gagtcagaggatgttattaaaggcaattccggcattgagtga

DBGET integrated database retrieval system