KEGG   Gallibacterium anatis: UMN179_00309Help
Entry
UMN179_00309      CDS       T01482                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
gan  Gallibacterium anatis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gan00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(315832..316665)
Genome map
AA seq 277 aa AA seqDB search
MKLYSKNQRVLDLSQAQVMGILNVTPDSFSDSGKFFSLDKALYHAEEMLKQGASIIDVGG
ESTRSMAEEVTLQQELDRVIPVVEAIRQRFDCWISVDTSKAEVMKAAADAGMDLINDIRA
LTEENALQTAAELDLPVCLMHMQGQPKTMQANPEYQNVVEEVLAWLLQRAAICEQAGVRK
ENIILDIGFGYGKTLQHNYQLLNHLEQFVATGYPLLIGLSRKSMIGNLLQKDVNHRLVGS
VAGALISVMKGAHIVRVHDVEATVDALKVWQATKAAI
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaaactatatagtaaaaatcaacgagtattggatctttcccaagcacaagtgatggga
attcttaatgtaacgccggactctttttctgatagcggcaaatttttttcattggataaa
gcgttatatcacgccgaagagatgctaaaacaaggtgcgagcattattgatgttggtggt
gaatcgacgcgatcaatggcggaagaggtaacgttgcagcaagaattggatcgggtgatt
cctgtggttgaagcgattagacagcgttttgattgttggatttcagtggatacctcaaaa
gcggaagtaatgaaagctgccgcggatgccggaatggacttaattaatgatattcgcgca
ttaacagaagagaatgctttacaaacagcagcagaattggatttgccggtctgcttaatg
catatgcaggggcaaccgaaaacaatgcaagctaaccctgaatatcagaatgtggtggaa
gaggtgctggcgtggctgttacaacgggcagcgatttgtgagcaggcaggtgtgcgaaaa
gaaaatattattttggatatcggcttcggttacggtaaaactttgcagcacaattaccaa
ttattgaatcatttagagcaatttgttgccaccggttatccgttattaatcggtttgtca
cgaaaatcgatgatcggtaatttgttgcagaaagatgtcaatcatcgcttagtcggtagt
gttgccggtgcgttgatttcagtaatgaaaggagcgcatattgtcagagtgcacgatgtc
gaagcgacagttgatgcgttaaaagtatggcaggcgacaaaagcggcaatttaa

DBGET integrated database retrieval system