KEGG   Gallibacterium anatis: UMN179_00454Help
Entry
UMN179_00454      CDS       T01482                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
gan  Gallibacterium anatis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gan00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:gan00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:gan02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
462685..464433
Genome map
AA seq 582 aa AA seqDB search
MKLRYLLTLMASAFALNSFAQTIYPIDRATMMVDGKFDFKVEFDEIVKPEQVKITINGKD
FTKVLGSNNIEFVEKEDGEPVSAIWLRNVSIQEPGKYQVTAQANGKSSKVNWTVYRTPDI
AKAKNVIFFLGDGLSVAHRTGARILSKGVTEGKANSLLAMDTLPVTGFIGTSSTDAITAD
SANTMSAYMTGHKSAINALGVYVSRSKDNLNHPKQETLGELIKRKTNKSLGIVSDAELED
ATPAAVVSHTRRRADKDKIAGMLYEVKPDVLLGGGSAYFLPKSVPGSKRKDDVNYIEKFK
EDGYQLVTTNTELTNIAKDTKQLLGLFHTGNMDTVLDRRFLKTEATKKFQDQPDLTTMTQ
TALDVLSQNPDGFFLMVESALIDKSSHPLDWERALMSTIMFDKSIEIAKKFAEKHPDTLI
IVTGDHTHGLSLIGTVDDNKPGDDMREKVGVYAAAGYPNYEDKNQDGYPDRLDVSKRLAA
FFNNYPDYYETFRPKLDGLFVPAIKNEKGEYVANEAYKSVPGAVLRTGILPKSESNGVHA
IDDIVIQAQGPGSEAIKGYMENSDIFKVIVDSFAINGKEKGK
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaagttacgctatttactgacgttgatggcatctgcattcgcattaaattcatttgcc
caaaccatttatccgattgatcgtgccacaatgatggttgacggcaaatttgattttaaa
gtggaatttgacgaaattgtaaaaccggaacaggtaaaaattaccattaacggcaaagat
ttcactaaagtattaggtagtaacaacattgaatttgttgaaaaagaagatggcgagcca
gtttctgcgatatggttaagaaatgtcagtattcaagaaccagggaaatatcaagttacc
gcacaagcaaacggtaaaagcagcaaagtaaattggacagtttatcgcacacctgatatt
gccaaagccaaaaatgttatcttctttttaggtgatggcttatccgtggcgcaccgtacc
ggcgcgcgcattttatctaaaggtgtaactgaaggaaaagcaaatagtttattagctatg
gatacgctgccggtaaccggttttatcggcacatccagtactgatgccatcacggcggac
agtgccaacacgatgagtgcctatatgaccgggcataaatcagccattaatgctctcggt
gtctatgtcagccgctctaaagataatcttaatcacccgaaacaggaaacactcggtgaa
ttaattaaacgtaaaactaataaaagtttaggtattgtttccgatgcagaattggaagat
gccacaccggcagccgttgtttctcataccagacggcgtgcagataaagataaaattgcc
ggaatgctttatgaagtcaaaccggatgtattgttaggcgggggttctgcttatttccta
ccaaaatcagtaccgggctcaaagcgtaaagatgatgtcaattatattgaaaaatttaag
gaggacggttatcagttagttacaaccaataccgaattaaccaatattgctaaagatact
aagcagttattagggttattccataccggcaatatggataccgttttagatcgccgtttt
ctaaaaaccgaagcgaccaaaaaattccaggatcaacctgatctcaccacaatgacacaa
acggcattagatgtattatcccaaaatccggacggttttttcttaatggtggaatccgca
ttaatcgataaatcttctcatccgcttgattgggaacgtgctttgatgagtacgattatg
tttgataaatcgattgaaattgctaaaaaattcgccgaaaaacatccggatacattaatt
attgttaccggagatcatacgcacggtttatcgttaatcggaacagtagacgacaacaaa
ccgggtgatgatatgcgagaaaaagtcggcgtttacgcagccgccggttatccgaattat
gaagataaaaaccaagacggctatcctgatagattggatgttagcaaacgtttagcggca
ttctttaacaattatcctgattattacgaaactttccgcccaaaacttgatggtctattt
gtccccgccattaaaaacgagaaaggtgaatatgtcgccaatgaagcctataagtcggtg
ccgggtgcggtattgcgtaccggcattctgccaaaaagtgaatccaacggcgtacacgct
attgatgacatcgtcattcaagcacaaggcccgggatcagaagcgattaaaggctatatg
gaaaactccgatattttcaaagttatcgttgacagcttcgccattaacggcaaagaaaaa
gggaaataa

DBGET integrated database retrieval system