KEGG   Gallibacterium anatis: UMN179_00520Help
Entry
UMN179_00520      CDS       T01482                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
gan  Gallibacterium anatis
Pathway
gan00010  Glycolysis / Gluconeogenesis
gan00620  Pyruvate metabolism
gan00640  Propanoate metabolism
gan00680  Methane metabolism
gan01100  Metabolic pathways
gan01110  Biosynthesis of secondary metabolites
gan01120  Microbial metabolism in diverse environments
gan01130  Biosynthesis of antibiotics
gan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN179_00520
   00620 Pyruvate metabolism
    UMN179_00520
   00640 Propanoate metabolism
    UMN179_00520
  Energy metabolism
   00680 Methane metabolism
    UMN179_00520
Enzymes [BR:gan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     UMN179_00520
Lipid biosynthesis proteins [BR:gan01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   UMN179_00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEC16556
UniProt: F4HCT8
Position
complement(535327..537291)
Genome map
AA seq 654 aa AA seqDB search
MQQLDSILKEDRVFPPSDEFRQQANIGNDEQYRQLWKFADEDYLHYWADLARELISWKKT
FMTIFDGSNAPFYKWFIDGKLNASYNCLDRHLPDKGDKVALIFESDFGQVNTYTYKQLHN
RVCRFANALREQGVKKGDRIVIYMPMLAEAVIAMQACARIGAIHSVVFGGFSASALRDRI
EDAQAKMVITANGGLRGGKIIPLKETVDSALEMGCESIEKVIVYYRLNIDTPWQEGRDLW
WHELSKDQPAFCEPEWMDAEDPLFILYTSGSTGKPKGIVHSTAGYLLGALNSFRNIFDNK
PEDVYWCSADVGWITGHSYVCYGPLANGATQVIYEGVPGYPDAGRIWRIIQRHKVNVFYT
SPTLIRSLTRFGDHIPHKYDLSSLRLLGSVGEPINPSAWMWFYQVIGKEKCPIVDTWWQT
ETGSIMLSPLPGITALKPGSCTLPQPGIMADVVDEEGNKVTNGNGGMLVIKRPFPSMLRT
IWNDDERYKKTYFPEELGGKYYVAGDSAHRDEDGYFWILGRTDDVLNVSGHRLGTMEIES
ALVANEKVAEAAVVGKPDEIKGESIVAFVVLNQAVIDDDEAKQVAEELKQWVSQEIGKIA
RPEDIRFADNLPKTRSGKIMRRLLRSIAKNEVITQDVSTLENPQIIGQLQRQIL
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaattagattctattttaaaagaagatcgagtttttccaccaagtgatgaattt
cgacaacaagcgaacatcggcaatgacgaacagtaccgacaattatggaaatttgcagat
gaagactatctccattattgggcagatttggcacgagaattaatcagttggaaaaaaacg
tttatgaccatttttgacggcagcaatgcgccgttttataaatggtttattgacggcaaa
cttaatgcttcatataactgcttggatcgccaccttccggataaaggcgacaaagtggcg
cttatttttgaatcagatttcggacaggtcaatacttacacctataaacagctacacaat
cgtgtctgccgttttgcgaatgcgctgcgtgaacaaggcgtgaaaaaaggcgatcggatc
gtgatttatatgccgatgttggcggaagcggtgattgcaatgcaggcgtgcgctcgaatc
ggcgcaattcactctgtggtattcggtggtttctccgccagtgctttgcgtgatcgtatt
gaagatgcgcaagccaaaatggtgattacagccaatggcggtttgcgtggcggtaaaatt
attccattaaaagaaacggttgatagcgcactggagatgggatgtgagtcaattgaaaaa
gtgattgtctattatcgtttaaatattgacacgccgtggcaagagggacgtgatctctgg
tggcacgagctttctaaagatcagccggctttttgtgaaccggaatggatggatgccgaa
gatccgctctttattctttatacctccggctcaaccggaaaaccaaaaggcattgtgcat
agcactgccggttatttattaggtgcacttaatagtttccggaatatttttgataacaaa
ccggaggatgtgtactggtgtagtgctgatgtgggttggattaccggccactcctatgtt
tgttacgggccgttggcaaacggtgcaacacaagtgatttatgaaggtgtgccgggttat
ccggatgccggacgtatttggcgtattattcagcgtcataaagtgaatgttttctacact
tccccaaccttaattcgttcattgacgcgtttcggtgatcatattccgcacaaatatgat
ctctcttcattgcgcttattgggcagcgttggtgaaccgattaacccatcagcttggatg
tggttttatcaggttattggcaaagaaaaatgccctattgtggatacttggtggcaaaca
gaaaccggttcaattatgttatcaccgctgccgggaattaccgcattgaaaccgggctct
tgcaccttaccgcaaccgggaattatggcggatgtggttgatgaagagggcaataaagtt
acgaatggcaatggcggtatgttagtgattaaacgcccgttcccgtcaatgttacgcacc
atttggaatgatgatgaacgctataagaaaacctatttccctgaagagttgggcggtaaa
tattatgttgccggtgattctgcgcatcgtgatgaagatggctacttctggattttagga
cgaacagacgatgtactgaatgtttccggtcaccgtttaggcacaatggaaattgaatct
gcgttagtcgcgaatgaaaaagttgccgaagcggcggtagtcggtaaaccggatgaaatc
aaaggtgaatcaattgtggcgtttgtggtgttgaatcaggcagtcattgacgatgatgaa
gcaaaacaggtggcagaagagttgaaacagtgggtatctcaagaaattggaaaaattgcc
agaccggaagatattcgctttgccgacaacttgccgaaaacccgttccggtaagattatg
cgccgtctattgcgttctattgcgaaaaatgaagtgattacccaagatgtttccacttta
gaaaatccgcaaattattggacagctacaacggcaaattctgtaa

DBGET integrated database retrieval system