KEGG   Gallibacterium anatis: UMN179_00536Help
Entry
UMN179_00536      CDS       T01482                                 

Definition
(GenBank) di-heme cytochrome c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
gan  Gallibacterium anatis
Brite
Enzymes [BR:gan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     UMN179_00536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Haem_bd Cytochrom_C Cytochrome_CBB3 Cytochrom_NNT DUF1924 VIGSSK Cyclin_N DUF5472
Motif
Other DBs
NCBI-ProteinID: AEC16572
UniProt: F4HCV4
Position
complement(561828..563261)
Genome map
AA seq 477 aa AA seqDB search
MKPQSWLFTFIGAGAVAYLGTVAYIHHFDKQETQRRLQESQITDPQQRAVETVLYNNGCQ
YCHSNNANMPFYAKLPIASSLMEKDIHQGQAHFFLDNITDYLNQPQRISAADLAKLESVI
QNNEMPIHSFKMVHWGSGLNEQEKAILLDWIHKVRQEYQLPANTSGTSAERFVQPVPQSL
PVNPAKVELGNVLYHSTALSGDGTIACASCHSLNTGGVDNLATSTGIKGQKGGINAPTVY
NAVFNFAQFWDGRAANLAEQAGGPPLNPVEMGAENWQQIVDNLNKDESLKQAFEKIYPEG
FNEKNITDAIAEFEKTLITPNSPFDRYLQGDENALTATQKNGYALFHQYKCDTCHTGTNL
GGQSYELMGLKADYFADRNKPLTEADDGRFAQTKNPYDKHRFKVPTLRNVALTAPYFHDA
NAQDLTQAVEMMLKYQSGVSLSKEQVSDIVDFLHSLTGEYQGKPLTNENIQSSQSTK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctcaatcgtggttatttacatttattggtgcaggtgccgtcgcttatctaggg
acggtggcatatatccaccactttgataaacaagaaacacaacgccgtttgcaagaaagt
caaattactgatcctcagcaacgtgccgttgaaaccgtgctatataataatggctgtcaa
tattgccatagtaacaatgctaatatgccattttatgccaaattgcctatcgctagcagt
ttaatggaaaaagatattcatcaaggacaagctcatttttttctggataatatcacagat
tatctcaaccaacctcaacgcatttccgcagcagatttagcgaaacttgaaagtgttatt
caaaataacgaaatgcctattcattcttttaaaatggtgcattggggatctggtttaaac
gagcaagagaaagcaatcttgcttgattggattcataaagttcgccaagaataccaactt
cctgcaaacacctctggtacatcagcagaacgttttgtacaacctgtgccacaaagtttg
ccggttaatcctgccaaagtggagctaggtaacgtgctttatcatagcacagccttatct
ggcgatgggacgattgcttgtgctagttgtcatagtttaaatacgggtggtgtggataac
cttgctacttctaccggaattaaaggacagaaaggaggcattaatgcaccgactgtctat
aatgctgttttcaactttgctcaattctgggacggtcgtgcagcaaatctagccgaacaa
gctggtgggcctcctttaaaccctgtagaaatgggagcagaaaattggcaacaaattgtt
gataatctcaacaaagatgagtcgctcaaacaagcctttgaaaaaatttacccggaaggt
tttaatgaaaaaaatattactgatgccattgcagagtttgaaaaaactttaatcacgcca
aacagtccattcgatcgttatttacaaggtgatgaaaatgcattaactgcaacacaaaaa
aatggttatgcgttattccaccaatataaatgtgatacttgtcatactggcactaattta
ggtggtcaatcttatgaattaatgggattaaaagcagattattttgctgatcgcaataaa
ccattaacagaagcagatgacggtcgctttgctcaaacgaaaaatccttatgataaacat
cgttttaaagtgcctacattgcgtaatgttgcacttaccgcaccttatttccacgatgca
aatgcacaagatttaacccaagcagtggaaatgatgttgaaatatcaaagtggtgtaagt
ttatcaaaagagcaagtgagcgatattgttgatttcttacatagtttaacgggagaatac
caaggaaagccgttaacaaatgagaatatacaatcctctcaatcaacaaaataa

DBGET integrated database retrieval system