KEGG   Gallibacterium anatis: UMN179_00668Help
Entry
UMN179_00668      CDS       T01482                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihyropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
gan  Gallibacterium anatis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UMN179_00668
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     UMN179_00668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
714610..715092
Genome map
AA seq 160 aa AA seqDB search
MNNVYIALGSNLNNPLAQLTQAVQTLKQHPDLKVKKVSPFYGSKPLGPQDQPDYVNAVAQ
IETDLEPLALLDALQSIENSQGRVRLRRWGERTLDLDILLFNQDVISHPRLTVPHCEMKN
REFVIIPLFDIAPNLIFPNGESLSEIAEQFKSHQMWKLSD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgtttatatcgcattaggcagtaatctgaacaatcctttagcacaattaacg
caggctgttcagaccttaaaacaacatccggatcttaaagtgaaaaaggtcagccctttt
tacggcagtaagccgttaggaccacaggatcagcctgattacgtcaatgcggttgcgcaa
atagaaaccgaccttgaaccgttagccctgttggatgcactgcaatccattgaaaatagt
caaggtcgggtcagattacgccgctggggagagcgtacacttgatctggatattctactg
tttaatcaagatgttatttcacatcctcgtttaacggttcctcattgcgaaatgaaaaat
cgagagtttgtgattattcctttattcgacattgcccctaatttgattttcccaaatggc
gaatctttatcagaaatagccgaacaatttaaatcacatcaaatgtggaaattatcagac
taa

DBGET integrated database retrieval system