KEGG   Gallibacterium anatis: UMN179_00679Help
Entry
UMN179_00679      CDS       T01482                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
gan  Gallibacterium anatis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UMN179_00679
   01230 Biosynthesis of amino acids
    UMN179_00679
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN179_00679
   00051 Fructose and mannose metabolism
    UMN179_00679
   00562 Inositol phosphate metabolism
    UMN179_00679
Enzymes [BR:gan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     UMN179_00679
Exosome [BR:gan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   UMN179_00679
  Exosomal proteins of bladder cancer cells
   UMN179_00679
  Exosomal proteins of melanoma cells
   UMN179_00679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(729508..730275)
Genome map
AA seq 255 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELINGLKAELAGVEGCDVAIAPPVMYLAEAEAALAGSKI
ALGSQNVDLKQSGAFTGDISATMLKDFGAKYIIIGHSERRAYHHESDEFIAQKFAVLKEQ
GLVPVLCIGESEAENEAGKTEEVCARQIDAVLNTLGAEAFLGAVIAYEPIWAIGTGKSAT
PAQAQAVHAFIRSHIAKKDAKVAEQVILQYGGSVNDGNAAELFAMPDIDGALVGGASLKA
PAFATIVKAAAKAKN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcgtcctttagttatgggcaactggaaattaaacggtagcaaggcatttacc
aaagaattgatcaatggtttgaaagctgaattagcaggtgttgaaggttgtgatgtggca
attgctccgccggtaatgtatttagcagaagcggaagctgcattagccggtagcaaaatt
gcattaggctcacaaaatgttgatcttaaacagtccggcgcgtttaccggtgatatttct
gcaacaatgttaaaagatttcggtgcaaaatatatcattatcggtcactctgaacgtcgc
gcatatcaccacgaaagcgatgaatttattgcacaaaaatttgcagtattaaaagaacaa
ggtttagtgccggtgctttgtattggtgaaagtgaagcggaaaatgaagcaggaaaaaca
gaagaagtttgtgcaagacaaatcgatgccgtgttaaataccttaggtgcagaagccttt
ttaggtgcagttattgcttatgaaccgatttgggcaatcggtacaggaaaatctgctact
ccggcacaagctcaagcggtgcacgctttcattcgtagccatattgcgaagaaagatgca
aaagttgccgaacaagtgattttacaatacggcggttctgttaatgacggcaatgcggca
gaattatttgcaatgccggatatcgatggcgcattagttggcggtgcttcattaaaagca
ccggcgtttgctaccatcgttaaagcagcggcaaaagcaaaaaattaa

DBGET integrated database retrieval system