KEGG   Gallibacterium anatis: UMN179_00730Help
Entry
UMN179_00730      CDS       T01482                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
gan  Gallibacterium anatis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    UMN179_00730
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     UMN179_00730
Exosome [BR:gan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UMN179_00730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
779940..781454
Genome map
AA seq 504 aa AA seqDB search
MTDKKYIIALDQGTTSSRAVLLDHDANIVGIAQREFTQIYPKTGWVEHDPMEIWATQSST
LNEVVAKTGITSDQIAAIGITNQRETTIVWNKNTGKPVYNAIVWQCRRTAEFCDQLKAKG
YTDYIRNTTGLVVDPYFSGTKVKWILDNVEGAREQAEKGELLFGTVDTWLIWKLTQGRVH
VTDYTNASRTMMFNIHSKQWDDKMLEILDIPRSMLPEVKNSSEIYGQTNIGGKGGVRIPI
AGIAGDQQAALYGHLCVNAGQAKNTYGTGCFMLMNTGDKAITSQNGLLTTICCNAKGEPA
YALEGSVFIAGASIQWLRDELKIVHDSADTEYFAQKVPDCNGVYVVPAFTGLGAPYWDPY
ARGAIVGLSRGANRNHIVRATLESIAYQTKDVLEAMLSDSDEKLQSLRVDGGATANNFLM
QFQADILNTQVERPTVKEVTALGAAYLAGLATGFWKDLEELRDKASIERTFLPDQNEAKQ
QRRYKGWKKAVKRALEWAKEDDEE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaaaaatatattattgctttagaccaaggtacaaccagctctcgtgcagtt
ttgcttgaccacgatgccaatattgtcggcattgcacaacgcgaatttacacaaatttat
ccaaaaacaggatgggttgaacacgatccgatggaaatttgggcaacgcaaagttcgacc
ttaaatgaagtggtggcaaaaaccggtattacttctgatcagatcgctgcaatcggaatt
accaatcagcgtgaaacaacgatcgtttggaataaaaataccggcaaaccggtttacaat
gcgattgtgtggcaatgccgtcgtaccgccgaattttgcgatcaattaaaagcgaaaggt
tataccgattatattcgtaatactaccggtttggtggtcgacccctatttctccggaaca
aaagtgaaatggattttagataacgttgaaggtgcgagagaacaggcggaaaaaggtgaa
ttgttattcggtacggtcgatacttggttgatttggaaacttactcaaggtcgtgtgcac
gttaccgattacactaatgcctctcgtacaatgatgtttaatattcatagcaaacagtgg
gatgacaagatgttagaaattttggatattcctcgtagtatgttgccggaagtgaaaaat
tcttccgaaatttatggtcaaaccaatatcggtggtaaaggtggcgtgcgtattccaatc
gccggtattgccggtgaccaacaagctgcgctttacgggcatctttgcgttaacgccggt
caggcaaaaaacacttacggcacaggttgctttatgttgatgaacaccggtgataaagct
attacctcacaaaatgggctattaaccactatctgttgtaacgccaaaggtgaacctgct
tacgctttagagggttctgtctttattgccggtgcgtcaatccaatggttgcgcgatgaa
ttaaaaattgtccacgacagtgccgataccgaatatttcgctcaaaaagtgccggattgt
aacggcgtctatgttgttccggcatttaccggtttaggtgcaccttattgggatccatat
gcacgtggtgctattgttggactttctcgtggggctaaccgtaaccatattgtcagagca
acgcttgaatctatcgcataccaaactaaggatgttttggaagcgatgttgtccgactca
gatgaaaaattgcaatcattgcgtgttgatggcggcgccaccgcgaataatttcttaatg
cagttccaagctgatattcttaacactcaagtggaacgcccgactgtcaaagaagtcacc
gcgctcggtgccgcttatcttgccggcttagcgaccggattctggaaagatcttgaagag
ttgcgcgacaaagcttctatcgaaagaacattcttgccggatcaaaacgaagctaaacag
caacgccgttataaaggttggaaaaaagccgttaagcgtgccttagaatgggcaaaagag
gacgatgaagaataa

DBGET integrated database retrieval system