KEGG   Gallibacterium anatis: UMN179_00806Help
Entry
UMN179_00806      CDS       T01482                                 

Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
gan  Gallibacterium anatis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UMN179_00806
Enzymes [BR:gan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     UMN179_00806
Peptidases [BR:gan01002]
 Cysteine Peptidases
  Family C44
   UMN179_00806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
863877..865460
Genome map
AA seq 527 aa AA seqDB search
MCGFVFSSSAQTSKAFKQSFDHIFHRGPDHQAVIYADDATWGFHRLSIMDLSSQGNQPFQ
YEGISLICNGEIYNYEELKSLLSSSYSFQSGSDCEVLIPLYQRVGVDVMMKMLDAEFALV
LKDSHTGDLIAGRDPIGIRPMFYGFDKESGGIAFSSEAKGLIGWCRDIQPFPPGHYYLNG
EFICYNDIADPKVVRDQDLDTITQTLRTKLETAVIKRLHSDAPLGFLLSGGLDSSLVCAI
AQKHLDKPIKTFAIGMDTDPIDLKYAKEVADYLGSEHTEVIMSKDEVLDALEKVIWHLET
WDITTIRASIGMYLVCKYIHENTDLKVLLTGEVSDEIFGYKYTDFAPNAAEFQKEAQKRI
RELYMYDVLRADRCLAANSLEARVPFGDIDFVDYAMSINPEKKMNVYNKGKYLLRKAFEG
TEYLPDSILYREKAAFSDAVGHSMVDHLKAFAESKYSDEELAQAKQKYPYGTPFTKESLL
YRDIFEKFYPGQSHWIKDFWMPNKEWEGCNVNDPSARVLNNYGDSGK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggattcgttttttcatcttcagcacaaacgtccaaagcttttaaacaaagcttt
gatcatatttttcatcgtggaccggatcatcaagccgttatttatgcggatgatgccact
tggggcttccatcgtttatccattatggatttaagctcacaaggcaaccaaccgttccaa
tatgaaggcatttccttaatctgcaacggagaaatttataactacgaagaactaaaatct
ttattatcaagtagttacagttttcaatccggcagtgactgcgaagtgcttatcccactt
tatcaacgtgtcggtgtggatgtgatgatgaaaatgttagatgcggaatttgcgttggta
ttaaaagacagccacaccggcgatttaattgccggacgtgatcccatcggcattcgccca
atgttttatggttttgataaagagagcggcggcatcgcattctcttccgaagcgaaaggg
cttatcggctggtgtcgtgacattcaaccattcccacccggacactattatttgaacggt
gaatttatctgctataacgatattgccgatccgaaagtggtgcgtgatcaagatcttgat
accatcacacaaacattgcgaacaaaacttgaaacagcagtgattaagcgtttgcattct
gatgcaccgctcggatttctgttaagtggcggtttagattcctccttagtatgtgcgatt
gcgcagaaacacttggataaaccaatcaaaacctttgcaatcggaatggataccgatccg
atcgatttaaaatatgcgaaagaggttgccgattatctcggttctgaacatactgaagtc
attatgagcaaagatgaagtgttggatgcgttggaaaaagtgatttggcacttggaaact
tgggatattaccactattcgtgccagcatcggaatgtacttggtctgcaaatatattcac
gaaaacaccgatttaaaagtgctcttaaccggtgaagtcagtgatgaaatttttggttat
aaatataccgattttgcaccgaatgctgccgaattccaaaaagaggcacaaaaacgcatt
cgtgaattatatatgtatgacgtgttgcgtgctgaccgctgtttggcggcaaactcgctg
gaagctcgtgttccgttcggtgatattgatttcgttgattacgcaatgagcattaaccct
gagaaaaaaatgaacgtctacaacaaaggaaaatatctgttgcgtaaggcgtttgaaggc
acagaatatttgccagacagcattctataccgtgaaaaagctgctttcagcgatgcagtg
ggacactcaatggttgaccatttgaaagcgtttgccgaaagcaaatatagcgatgaagag
ttggcgcaggcaaaacaaaaatatccatatggcacaccatttactaaagaatccctttta
tatcgtgatatttttgaaaaattctatccggggcaaagccattggattaaagatttctgg
atgccgaataaagaatgggaagggtgcaatgtaaatgaccctagtgcacgtgtgctgaat
aactatggcgacagtggcaaataa

DBGET integrated database retrieval system