KEGG   Gallibacterium anatis: UMN179_00897Help
Entry
UMN179_00897      CDS       T01482                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gan  Gallibacterium anatis
Pathway
gan00230  Purine metabolism
gan01100  Metabolic pathways
Module
gan_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UMN179_00897
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     UMN179_00897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 ABC_tran AAA_16 MMR_HSR1 AAA_22 RsgA_GTPase Rsa3 cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: AEC16925
UniProt: F4HF05
Position
complement(964230..964859)
Genome map
AA seq 209 aa AA seqDB search
MPLGNLYIVSAPSGAGKSSLISALLQQQPSYEMQVSISHTTRQPRPNEEHGKHYYFVDHK
EFERLIAEDAFLEYAQVFGNYYGTSLPMIERSLKQGIDVFLDIDWQGAQQVRKKVPAAKS
IFILPPSLQELERRLVGRGQDSNEVIAARMKKAISEISHYDEYDYLIINDDFDQALSEIK
VILKAEKLRVERQVQRHQLLISQLLAKSE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgccattaggaaatttatatattgtatctgcgccgagcggtgcagggaaatcttcgcta
atttctgcactattgcagcaacagccaagctatgaaatgcaggtttccatttcgcatact
acgcgtcaaccgcgtccgaatgaggagcatggaaaacattattattttgttgatcataaa
gaattcgagcgattaattgcggaagatgcttttttagaatatgcgcaagtcttcggaaat
tattacggtacttcattgccgatgattgagcgttcattaaaacaagggattgatgttttt
ttggatattgattggcaaggcgctcagcaggtgagaaaaaaagtaccggcggcaaaaagt
atttttatcctaccgccgtcactgcaagaattagaacgaagattggttggtcgcggtcag
gattcgaatgaagtgattgctgcaagaatgaaaaaagcgatcagtgaaatcagtcattat
gatgaatatgattatttaattattaatgatgattttgatcaggcattgagtgaaattaag
gtgattttaaaagcggaaaaattgcgggtcgaacggcaagtgcaacgccatcaattatta
atttcacaactactggcgaaatcggaatag

DBGET integrated database retrieval system