KEGG   Gallibacterium anatis: UMN179_00932Help
Entry
UMN179_00932      CDS       T01482                                 

Definition
fructokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
gan  Gallibacterium anatis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UMN179_00932
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN179_00932
   00052 Galactose metabolism
    UMN179_00932
   00500 Starch and sucrose metabolism
    UMN179_00932
   00520 Amino sugar and nucleotide sugar metabolism
    UMN179_00932
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    UMN179_00932
   00524 Butirosin and neomycin biosynthesis
    UMN179_00932
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     UMN179_00932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1007829..1008824
Genome map
AA seq 331 aa AA seqDB search
MEYYVGIDIGGTNTKIGIVDNHCNILIERAIKTLSIQGAQQTFARIWQTVQDMANALNIS
TDQLLGIGLGIPGLVVNQAIISRASNFSWGDNFNAKQLMEDISQKFVKVEKDVNNIALGE
LLFGSGRGFNNIIVISIGTGLSAGIIIDQKILSGVNGCAGEFGHIVVNEKGLKCGCGLTG
CLETYASATGILRETKRLILEKKVGMLSEQFYHYLSDLEVSHIFDFYNKNDEIAIEVIEN
FCKYLAYGLGVLLNTVDPELVILAGGVSKSADLIIQKVKIYLTRYALSTSLEKIQIKHCQ
LLDSAGIKGAASLVINDYRHRTHNESNIISL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggaatattatgttggtattgatatcgggggcactaatactaaaatcggtattgtggat
aatcattgtaatatcctcattgaacgcgctatcaaaacactatccatacaaggtgcacaa
caaacatttgctcgtatttggcagacagtacaagatatggcaaatgcattgaatatctct
actgatcaattactcggtataggtttaggtattcccggtttagtcgtaaatcaagcaatt
atctcgcgtgcttcaaacttctcttggggagataactttaacgctaaacaattaatggaa
gatatttctcaaaaattcgtgaaagtcgaaaaagacgtgaataatatcgctttaggagaa
ttattattcggtagtggtcgaggctttaataatattattgtcatatctattggtacgggg
ttgtccgccggtatcattattgatcaaaaaatcttatctggagtaaatggttgtgccggt
gagtttggtcatattgtggttaatgaaaaaggattaaaatgtggttgtggtttaaccgga
tgtcttgaaacttatgcctctgccactggaattcttagagaaactaaaagactgatactt
gaaaagaaagtaggaatgttgagtgaacaattctatcattacttatctgacttagaagtc
agccatatatttgatttttacaataaaaatgatgaaattgcgattgaagtaatagaaaat
ttctgcaaatatttagcttacggattgggtgtattgttaaatacagttgatccagaactt
gtgattttagctggaggcgtttctaaatcagcagatttaatcatacaaaaagtaaaaata
tatctaactcgttatgcattatctacatctttagagaaaatccaaataaaacactgtcaa
ttacttgattctgccggtataaaaggcgctgcatcactcgttattaatgactataggcat
agaacacacaatgaatcaaatattatctccttatga

DBGET integrated database retrieval system