KEGG   Gallibacterium anatis: UMN179_01237Help
Entry
UMN179_01237      CDS       T01482                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
gan  Gallibacterium anatis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    UMN179_01237
Enzymes [BR:gan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     UMN179_01237
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1340250..1342007
Genome map
AA seq 585 aa AA seqDB search
MQSTKIKIGIRPTIDGRRMGVRESLEVQTMTMAQSVADLLQTHVRHTDGSFVECVIADSC
IGGVAEAAQCAEKFKAQNVGVVITVTPCWCYGSETIDMDPHMPKAIWGFNGTERPGAVYL
AAALAGHTQMGLPAFSIYGTEVQEADDTTIPDDVKEKLLRFAKAGLAVATIRGKSYLSIG
SVSMGIAGSIVDQSFFQHYLGMRNEYVDMTEIKRRLDREIYDPEEVKLALSWVKQYCQEG
IDVNKEEYQRTAEEKEALWETVVKMTIIARDLMIGNPKLAELNFGEEALGHNAIVAGFQG
QRHWTDHLPNGDFMEAMLNSTYDWNGVRPPFIMATENDSLNGVTMLLAHQLTGQAQIFAD
VRTYWSEDSVERVTGFRPTSGFLHLLNSGSAALDGTGQHLDETGNHLIKPVWEITEEDGK
RCLAHTRWCAAVHEYFRGGGLSSQFLTKGGLPFTMSRINLVKGLGPVLQLAEGWSIELPE
EVHNTLSQRTNETWPCTWFVPRLTGQGAFKDVYSVMANWGANHCVVSYGHIGADLITLAS
MLRIPVCMHNIKESDIFRPSAWSAFGQDKEGQDYRACTNFGPLYK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcaacaaaaattaaaattggtattcgtccaacgattgatggtcgtcgtatgggg
gttcgtgaatcattagaagtacaaacgatgacaatggctcagtctgttgccgatttgtta
caaactcacgttcgtcatacagacggttcatttgttgagtgtgtaatcgccgatagttgt
atcggtggtgttgcagaagctgcacagtgtgcagaaaaatttaaagcacagaatgtcggt
gttgtcattaccgttaccccttgttggtgttatggttcggaaacgattgatatggatcca
catatgccaaaagcaatctggggatttaatggtacagagcgtcccggagcggtttatttg
gctgctgccttagctggacatacccaaatgggattgcctgcattttctatttatggcaca
gaagttcaagaggctgatgacaccactattcctgatgatgtgaaagaaaaactgttacgt
tttgctaaagcgggtttagctgtggcaacgattcgaggtaaatcttatttatctatcggt
tctgtatcaatgggaattgctggctcaatagtagatcaatctttctttcaacattattta
ggaatgcggaatgaatatgttgatatgacagaaattaaacgccgtcttgatcgtgaaatt
tacgatcctgaagaagttaaattggcattgtcttgggtgaagcaatattgtcaagagggt
atagatgtcaataaagaagaatatcagcgtacagcagaggagaaagaagcactttgggaa
actgttgttaaaatgaccattattgcgcgtgatttgatgataggaaatccaaagttggct
gagcttaattttggcgaagaagcattaggacataatgctatcgttgctggcttccaaggt
caacgtcattggacagatcacttgccaaatggtgattttatggaagcaatgcttaactcc
acttacgattggaatggcgttcgcccacctttcattatggctactgaaaatgattcactt
aatggtgtcacgatgttactcgctcatcaattaactggacaagcacaaatttttgctgat
gtacgaacttattggagtgaggattctgttgagcgcgttacaggcttccgtccaacatca
ggttttttgcatttattaaattcaggatcagccgcattagatggtacaggtcaacattta
gatgaaacaggaaatcatttgatcaaaccggtatgggaaattactgaagaggacggtaaa
cgttgtcttgctcatacgcggtggtgtgctgcggtacacgaatatttccgtggaggcggt
ttatcctctcaatttctcaccaaaggtggcttaccattcacaatgagtcgtatcaacctt
gttaaagggcttgggccagtgctacaactggcagaaggatggtcaattgaactacctgaa
gaggtacacaataccttgagtcaacgtactaatgaaacgtggccttgtacttggtttgtt
cctcgtttaacaggacaaggtgcttttaaagatgtttattcagtaatggctaattgggga
gcaaatcactgtgtagtgagttatggacatatcggtgctgacttgatcacattagcatca
atgctccggattcctgtttgtatgcataatattaaagaaagtgacattttccgtccgagt
gcttggagtgcttttggtcaagataaagaaggacaagactatcgtgcttgcactaatttt
ggacctttatataagtaa

DBGET integrated database retrieval system