KEGG   Gallibacterium anatis: UMN179_01240Help
Entry
UMN179_01240      CDS       T01482                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gan  Gallibacterium anatis
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:gan00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1343932..1344579
Genome map
AA seq 215 aa AA seqDB search
MNRQQLSQKIIDTCLEMTRLGLNQGTAGNVSVRYQDGMLITPTGTPYEQMTVDSIVFVDK
NGRYEQGKLPSSEWHFHLAVYQSRQDVNAVVHNHAINCAAVSILEKSIPPFHYMIAVGGT
DHIPCVPYATFGTHQLAEYVADGIKTSKAILLAHHGLIAAEKNLDKALWLAHEVEVLAEW
YIKLLATGLDIPLLSKQQMAEVLEKFKSYGLRIEE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgacaacaactttcacaaaaaattattgatacttgtttagaaatgactcgttta
ggattgaaccaaggtacagcgggtaatgttagtgtgcgttatcaagatggaatgttgatt
acgccaacgggaacaccttatgagcaaatgacagtggatagcattgtttttgtcgataaa
aatgggcgttatgaacaaggaaaactaccatcaagtgaatggcattttcatttagccgtt
tatcaatcacgacaagacgttaatgccgtagtacataatcacgcaattaattgcgcggca
gtttctatcttagaaaaatcaataccaccttttcactatatgatcgctgtaggagggaca
gatcatattccgtgtgtaccttatgctacctttggcacacatcaattagctgaatatgta
gcagatggtattaaaacttcaaaagccattttattggctcatcacggcttgattgcagct
gaaaaaaatcttgataaagcattatggttagcccacgaagtggaagtattagccgaatgg
tatatcaaattattggcaacaggattagatattccactattgtcaaaacaacaaatggct
gaagtactggagaagtttaaatcttacggattacgtattgaagagtaa

DBGET integrated database retrieval system