KEGG   Gallibacterium anatis: UMN179_01291Help
Entry
UMN179_01291      CDS       T01482                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
gan  Gallibacterium anatis
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:gan00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1398446..1399369
Genome map
AA seq 307 aa AA seqDB search
MFNTLAHKEDISLVSNNFGFLRLPLNFVPQQSDADWVITGVPFDASVSGRAGARFGAEAI
RRASVNLAWEHCRFPWNFDVRERLKIVDCGDLVYSYGDNQDFVKQLEAHTSSLLQAGKRC
LTLGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENGSCYDHGTMFYHAPKEGLIDAK
RSVQIGIRTEFDRQLDFTVLDAPLVNDLTVDEVVQRIKETVGTELPVYLTFDIDCLDPAF
APGTGTPVCGGLSTDKVLKILRKLSDVNIVGMDVVEVSPAYDKADITALAGATIALEMLY
LQGSKKE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatacgcttgcgcataaagaagatatttctttggtttctaataattttggtttt
ttacgattaccgttaaattttgtgccacagcaatccgatgccgattgggtaatcactggc
gtgccgtttgatgcatctgtttccggtcgtgcgggggcaaggtttggcgcggaagcaatt
cgccgtgcttctgtcaatttagcgtgggaacattgccgtttcccgtggaattttgatgtg
cgggaacggttgaaaattgtcgattgtggcgatttagtctattcctatggcgataatcag
gattttgttaaacagctggaagcgcataccagttccttgctacaagccggaaaacgttgc
ctaactttaggtggtgatcactttatcacattgccgcttttgcgtgctcacgccaaacat
tttggtaaattggcaatgatccattttgatgcacataccgacacctacgaaaacggcagt
tgttatgatcacggtacaatgttttatcacgcgccgaaagagggattaatcgatgcaaaa
agatctgttcagatcggcattagaacagagtttgatcgacagttagacttcaccgttttg
gatgctccgctagtgaatgatttaactgttgatgaagtggttcagcgtattaaagaaaca
gttggaacggagttaccggtttacttgacattcgacattgattgcctcgatccggcattt
gctcccggcaccggcacaccggtttgcggtggattaagtacagataaagtattgaaaatt
ttaagaaagctgtctgatgtgaatattgttggaatggatgtggtggaagtttctcctgca
tatgacaaagcagatatcaccgcgcttgccggcgcaaccatcgctttagaaatgctttat
ttgcaagggagtaagaaggaatga

DBGET integrated database retrieval system