KEGG   Gallibacterium anatis: UMN179_01322Help
Entry
UMN179_01322      CDS       T01482                                 

Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
gan  Gallibacterium anatis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    UMN179_01322
Enzymes [BR:gan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     UMN179_01322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1431040..1431978
Genome map
AA seq 312 aa AA seqDB search
MVIKENFSQFVQQQLLPFVEQFPMQYIEANQQKKIAFRHFIHQAHQKLIVLVNGRAENIL
KWSEVAYDFYQQGFDVLLFDHRGQGFSDRLLKDREKGYIDRFQYYLDDMDLVIQTVLRKK
VYEKQYLLAHSMGGLISTCYLAKYPHQFNKVILSAPFWGLPQKTVKRDEIIVAIMTLLGF
SQHYVFGKGAYKAADLATTPLSHSTERMAFMNEIAEKYPNVRLGGPTFSWVHHCIIMFAK
LKGLIAKITVPALILQAEQDLIVSNTAINEFSSYFSDVILKNIEKSKHEILFETDEIRQS
AFKEIMAFLAKD
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggtaataaaagagaattttagtcaatttgttcaacaacagttattgccttttgttgag
caatttcctatgcaatatattgaagcaaatcagcagaaaaaaatagcgtttaggcatttt
attcatcaagcacatcaaaaattaattgtattggtaaatgggcgtgcggaaaatatttta
aagtggagcgaagttgcctatgatttttatcagcaaggatttgatgtgctgttatttgat
catcgagggcaaggattttctgatcgtttattaaaagatcgtgaaaaaggatatattgat
cgctttcaatattatttagatgatatggatttagtgatacaaaccgttctgcgaaaaaaa
gtgtatgaaaaacaatatcttttggcacattcaatgggcggtttaatttcaacttgttat
ttggctaaatatccgcatcaatttaataaagtgattttgtccgcgccattttggggatta
ccgcagaaaacagtaaaaagagatgaaattattgttgcaataatgacattactaggattt
tctcaacattatgtgtttggtaaaggtgcatataaagcggctgatttagcgacaacaccc
ttgagtcatagtacagaaagaatggcttttatgaatgaaattgctgaaaaatatccgaat
gttcggctgggaggaccaacattttcttgggtacatcattgtattattatgtttgcaaaa
ttgaaggggcttattgctaaaattacagtgccagctcttattttgcaggcggaacaggat
ttaattgtttctaatacagcaataaatgaattttcgagctatttctctgatgtaatatta
aaaaatattgagaaatcaaaacacgaaatattatttgaaacagatgaaattcgtcaatcc
gcctttaaagaaattatggcttttcttgctaaggattaa

DBGET integrated database retrieval system