KEGG   Gallibacterium anatis: UMN179_01397Help
Entry
UMN179_01397      CDS       T01482                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
gan  Gallibacterium anatis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UMN179_01397
   00670 One carbon pool by folate
    UMN179_01397
Enzymes [BR:gan01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     UMN179_01397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1519662..1520141
Genome map
AA seq 159 aa AA seqDB search
MLSLIVAMSKNRVIGRDNQMPWHLPADLAWFKKNTLGKPVIMGRKTFQSIGRALPNRKNI
VLSRQGFQADGIEVVSDLSQALALIKGENEVMVIGGGHLFAETLPIADRLYLTEIDAELQ
GDTFFPEIDPMVWKTNFIETRAADEKNRYALTFKILARV
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgctgagtttaattgtcgcgatgagcaaaaatcgagtaatcgggcgagataatcaaatg
ccttggcatttgccggcggatttagcgtggtttaaaaaaaatacattgggtaagccggtg
attatggggcggaagacctttcagtcgatcggcagagcattgccgaatcgcaaaaatatc
gtgttatcccgacaaggttttcaagcggatggtattgaagttgtttcagatttatctcaa
gcattagcattaataaagggtgagaatgaagtaatggttattggtggtggacatcttttt
gctgaaacattgccgatagcagatcgtctttatttaacagagattgatgcagaattgcaa
ggagatacttttttccctgagattgatccgatggtgtggaaaacaaattttattgaaaca
cgagcagcagatgagaaaaatcgttatgcgctgacctttaaaattttggcacgtgtgtag

DBGET integrated database retrieval system