KEGG   Gallibacterium anatis: UMN179_01404Help
Entry
UMN179_01404      CDS       T01482                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
gan  Gallibacterium anatis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    UMN179_01404
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN179_01404
   00620 Pyruvate metabolism
    UMN179_01404
   00650 Butanoate metabolism
    UMN179_01404
  Lipid metabolism
   00071 Fatty acid degradation
    UMN179_01404
  Amino acid metabolism
   00350 Tyrosine metabolism
    UMN179_01404
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    UMN179_01404
   00626 Naphthalene degradation
    UMN179_01404
Enzymes [BR:gan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     UMN179_01404
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     UMN179_01404
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1527199..1529814)
Genome map
AA seq 871 aa AA seqDB search
MSKTSEVVVSPAQAEVDQLVSNGLAALGEFRQLNQQQVDYIVAKASVAALDQHGVLAMHA
YEETGRGVFEDKATKNLFACEYVVNNMRHLKTVGVISEDDVTGITEIADPVGVICGITPT
TNPTSTAIFKALISLKTRNPIVFAFHPSAQQSSAHAARVVYEAAVAAGAPKNCIQWIENP
SMEGTQALMKHPGIATILATGGNAMVEAAYSCGKPALGVGAGNVPAYVEKSANLKQAVHD
IVMSKSFDNGMICASEQAAIVDKEIYDDFIKEMQSYGVYLVNKKEKALLEEFIFGAKANS
SSCSMAKLNAAVVGKPAAWIAEQAGFSVPANTNILLAECKEVGEKEPLTREKLSPVLALL
KAESTEDGLIKAEQMVEFHGLGHSAAIHTSDAELAKVFGERVKAIRVIWNSPSTFGGIGD
VYNSFLPSLTLGCGSYGKNSVGNNVSAVNLLNIKRVGRRRNNMQWFKVPSKIYFERDSIQ
YLQSMKGVERVVIVTDRVMVDLGFVEKIAKQLTMRGDHVTYQLFADVEPDPSIATVRRGV
ELLRNFQPDTIIALGGGSAMDAAKVMWLFYEQPEVDFRDLVQKFMDIRKRAFKFPQLGRK
AKFIGIPTTSGTGSEVTPFAVISEGDKKYPIADYSLTPTIAIVDPALTMTVPAHVAADSG
YDVLVHATEAYVSTLANDFTDGLALQAIKLVFEFLERSVKNGASDPEARERMHNASTIAG
MAFANAFLGMTHSLAHKVGGRFHTPHGRTNAILMPYVIRYNGTRPTKTATWPKYNYYKAD
VKYQEIARMLGLPCSTPEEAVEAYANACKELGQKVGIKMSFKEQGINEQEFMEARRDLAL
LAFEDQCSPANPRLPMVEDMIEILTKSYYGE
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaacatccgaagtggtggtaagtcctgctcaggcagaagtggatcaactcgtc
tccaatggcttagccgccttgggagagttccgtcagcttaatcagcaacaagtcgattat
atcgttgcgaaggcttctgtcgccgcattggatcaacacggcgtgttggcaatgcacgct
tatgaagaaaccggtcgtggcgtatttgaagacaaagcaacaaaaaatctgtttgcttgt
gaatatgttgtaaacaatatgcgtcatttgaaaactgttggtgtgattagtgaagacgat
gttaccggtattaccgaaattgccgatccagttggagtgatttgtggtattacgccaacc
accaatccaacctctaccgcaatttttaaagccttaatttccttaaaaactcgtaatccg
atcgtttttgcattccacccatccgctcaacaaagttccgctcacgccgcacgcgttgtt
tatgaagcggctgttgctgccggcgcgccgaaaaactgtattcaatggattgaaaaccca
tctatggaaggcactcaggcattaatgaaacacccggggatcgccactattctagccacc
ggcggaaatgcgatggtggaagcggcttattcctgtggtaaaccggctttaggtgtcggt
gccggaaatgtgcctgcttatgtggaaaaaagtgcaaatttaaaacaggcagtacacgac
attgtgatgtcaaaatcgtttgataacggaatgatctgtgccagcgaacaggcagcaatt
gttgataaagaaatttatgatgattttattaaagagatgcaatcttacggcgtttatctc
gttaataaaaaagaaaaagcattacttgaagagtttatcttcggtgcaaaagccaacagc
agcagctgttctatggcaaaactcaatgccgctgtagttggtaaaccggcagcgtggatt
gcggaacaggcaggcttcagcgtgccggcaaataccaatatcctgttggcagaatgcaaa
gaagtaggggagaaagagccattaactcgagaaaaactctcgccagtattagctttattg
aaagcggaaagcactgaagacggtttaatcaaagccgaacaaatggtggaattccacggt
ttaggacactccgccgccattcacacttccgatgcggaattggcaaaagtattcggcgaa
cgtgtcaaagccattcgtgtgatttggaactccccttcaacttttggcggtatcggtgat
gtttataactcgttcctaccttcattgaccttaggctgtggttcttacggtaaaaattct
gtgggcaacaatgtcagtgcagtgaatttattaaatattaaacgggtaggaagacggaga
aataatatgcaatggttcaaagtgccttcaaaaatctattttgaacgtgattcaatccaa
tatttacaatcaatgaaaggcgttgaacgtgtcgtgatcgttaccgatcgtgtaatggtt
gatcttggttttgtagaaaaaatcgcaaaacaactcacaatgcgcggcgatcacgtcact
tatcagcttttcgccgatgtagagccggatccgagcattgcaaccgtacgccgtggtgtt
gagttattgcgtaatttccaaccggataccattatcgcactcggtggcggctctgcgatg
gatgctgctaaagtaatgtggttattctatgagcaacctgaagttgatttccgcgatttg
gtgcagaaatttatggacattcgcaaacgtgcctttaaattcccacaattaggccgcaaa
gcgaaatttatcggtattccaaccacatcaggtaccggttctgaagtcacgcctttcgcc
gtgattagcgaaggtgataaaaaatatccaatcgctgattactcattaacaccgaccatt
gccattgtcgatccggcattaacaatgaccgtgccggcgcacgtggcggcagattccggc
tatgatgtattggtgcacgccaccgaagcttatgtatcaactttagccaacgatttcact
gacggcttggcattgcaagcaattaaattagtctttgaattcttggaacgctcggtgaaa
aatggagctagcgatccggaagctcgcgaaagaatgcataacgcctccactattgccgga
atggcttttgccaatgcgttcttagggatgacacactctttagctcacaaagtaggtggt
cgcttccacacaccacacggcagaactaatgctattttgatgccttacgtgattcgttat
aacggcactcgccctactaaaacagcgacttggccaaaatataattactacaaagcggat
gtgaaatatcaggaaatcgctagaatgttaggcttaccttgttcaacacctgaagaggca
gtggaagcttatgccaatgcgtgtaaagagttagggcaaaaagtcggtattaagatgtca
ttcaaagaacagggcatcaatgaacaagagtttatggaagcgcgccgtgatttagcttta
ttggcgtttgaagatcaatgctcaccggcaaaccctcgcttaccgatggttgaagatatg
attgagattttaaccaaatcttattatggtgaataa

DBGET integrated database retrieval system