KEGG   Gallibacterium anatis: UMN179_01523Help
Entry
UMN179_01523      CDS       T01482                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
gan  Gallibacterium anatis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    UMN179_01523
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     UMN179_01523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1651341..1652261
Genome map
AA seq 306 aa AA seqDB search
MQKLTVLGSINADHVIQVPHFPQPGETLSGQNYHIVYGGKGANQAVAAARLGAKVDFIAC
IGEDKIGLEMKQAFQKDGINTESIATIQGETTGIAMIQVTDSGENSIVISAGANAHLTTD
IVDKFKQKILDADALLMQLETPLDAIIYATKIAKQAGKHTVLNPAPAKALPDELLAQLTM
ITPNETEAELLTGVKVVDEQSAAQAAAVFHQKGVAIVLITLGAKGVFISHNALQKIIPGF
RVQAKDTTAAGDTFNGALVTALLEQKSLEEAIQFAHAAAAISVTRFGAQTSIPSRQETLD
FLANIK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaactcaccgttcttggcagtattaatgccgatcacgttattcaagttcctcat
tttccacaaccgggagaaactttatccggtcaaaattaccatatcgtctatggcgggaaa
ggtgcaaatcaagcggtggcggcggctcgcttgggggcaaaagtcgattttattgcttgt
attggcgaagataaaatcgggcttgagatgaaacaggcttttcaaaaagatggcataaac
accgaaagcatcgctacaattcaaggtgaaactaccggtatcgcgatgatccaagttacc
gacagcggtgaaaacagtatcgtcatttcagccggtgccaatgctcatctcaccactgac
attgtggacaaatttaaacagaaaattcttgatgctgatgcgctcttgatgcaactggaa
acgccgttggacgccattatttatgccaccaaaattgcgaaacaagctggcaaacacact
gtgctaaacccagcgccggcaaaagcgttaccggatgagttgcttgctcaattaacgatg
attaccccgaatgaaaccgaagcggaactgttgaccggcgtcaaagtggtagatgaacag
agcgcggcacaggctgcggcagtgtttcatcaaaaaggggttgccattgttttgattaca
ttgggggcaaaaggggtatttatcagtcacaatgcattacaaaaaattatccccggcttc
cgtgttcaggcaaaagacaccaccgccgccggcgatacttttaacggtgcgttggtaact
gcattgttggaacagaaatcactggaagaagcgattcagtttgcccacgcggcagccgct
atcagtgttacccgtttcggtgcgcaaacttctattccgagccgtcaggaaacgctcgat
tttttagccaatatcaaatag

DBGET integrated database retrieval system