KEGG   Gallibacterium anatis: UMN179_01529Help
Entry
UMN179_01529      CDS       T01482                                 

Definition
phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
gan  Gallibacterium anatis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    UMN179_01529
   00565 Ether lipid metabolism
    UMN179_01529
   00590 Arachidonic acid metabolism
    UMN179_01529
   00591 Linoleic acid metabolism
    UMN179_01529
   00592 alpha-Linolenic acid metabolism
    UMN179_01529
Enzymes [BR:gan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     UMN179_01529
    3.1.1.32  phospholipase A1
     UMN179_01529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1658793..1659635)
Genome map
AA seq 280 aa AA seqDB search
MRFRHCLVAFSTLLALSSATASLLPYQSRTALLLTQAPDNFVGLRPYEQNYLMETFSNKN
YNYPENMRHDEIKFQISVALPLWKGILGENSVLAGAYTQRSWFQFSNRGESSPFRESNYQ
PQLFVAWATDYDLPFGWKLVDVETGVVHTSNGRSDQQLKSRSWNRLYLRAGFSKDNWLVE
LKPYWRIPEKTEDDDNPDIVDYYGYGDVSVGYRFDEHILKTTARYNPRTNKGGMELSWSY
PIAKYVRVYAQYYHGYGESLLDYNRSTDRIGLGISLNNVF
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcagacattgcttggtcgcattttctacattattggcattatcatcggcaaca
gcgagtttattaccttaccaaagcagaaccgcactgttattgacacaagcgccggataat
tttgtgggattgcgaccatacgaacagaattatttaatggaaacattctccaataaaaat
tacaactacccggaaaatatgcgccacgatgagatcaaattccagatcagtgttgctttg
ccgttatggaaagggattttgggtgaaaattctgtacttgcaggtgcatatacccagcgt
tcgtggtttcagttcagtaatcgtggcgaatcttcgccattccgtgaaagtaattatcaa
ccacagctgtttgtagcgtgggctaccgactatgatttgccgtttggttggaaattagtg
gatgttgaaaccggcgtggttcacacatcaaacgggcgtagtgatcaacagttaaaatca
cgcagctggaatcggctttatttacgagctggcttcagtaaggataactggttggtcgaa
ttaaaaccttattggcgtattccggaaaaaacggaggatgatgataatccggatattgtt
gattattatggttatggtgatgtcagcgtgggttatcggtttgatgaacatattctgaaa
acgactgcacgttataatccacgaaccaataaaggcggaatggagctttcgtggagttat
ccaattgccaaatatgttcgtgtttatgcgcaatattatcacggttatggcgaatcatta
ttggactataaccgttccaccgatcgcatcggtttaggtatcagtttaaacaatgtgttc
taa

DBGET integrated database retrieval system