KEGG   Gallibacterium anatis: UMN179_01570Help
Entry
UMN179_01570      CDS       T01482                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase subunit GalU
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gan  Gallibacterium anatis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UMN179_01570
   00052 Galactose metabolism
    UMN179_01570
   00500 Starch and sucrose metabolism
    UMN179_01570
   00520 Amino sugar and nucleotide sugar metabolism
    UMN179_01570
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     UMN179_01570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1710251..1711138
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTIADKPLIQYIVSECVAAGIKEIILVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSICPKDVTIMHVRQGYAKGLGHAVLCGKALVGN
EPFAVVLPDVILAEFTADQKTENLAAMIKRFEQTHASQIMVAPVAKEDVSSYGIVDCGDE
DLSQQESAVIKNIVEKPSVDKAPSNYAVVGRYVFSAAIWDLLARTPVGVGDEIQLTDAID
MLIKQETVEAFTMKGRTFDCGDKLGYMQAFVEYSLHHPKLGAEFKTYLKQLATKI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgataattcctgttgcaggtttaggaacaagaatgttaccggcgacaaaagcg
attccaaaagagatgttgacgattgcggataaaccgttaattcaatatatcgtcagtgaa
tgcgttgctgccggcattaaagaaattattttggtaacacactcttcaaaaaatgcgata
gaaaaccacttcgatacctcgtttgaattggaaacaatgttggaaaaacgggtaaaacgc
caattattggaagaggtgcgttcaatttgcccgaaagatgtcaccattatgcacgtacgc
caaggttatgctaaaggattaggacacgcggtgctttgcggtaaagcattggtcggaaac
gaaccttttgccgtagtattgccggatgtgattttggctgaattcaccgccgatcaaaaa
acagaaaacttagcggcaatgattaaacgttttgaacagactcacgccagccaaattatg
gtggcgccggtagcaaaagaagatgtttccagctatgggattgttgattgcggcgatgaa
gatctcagccagcaagaaagcgctgtcattaaaaatatcgtagaaaaaccaagcgtcgat
aaagccccttccaattatgctgtggtcggacgctatgttttctccgctgcaatttgggat
cttcttgccagaacaccggtcggtgtcggcgatgaaatccaattaactgatgccattgat
atgttgattaaacaggaaaccgtagaagcctttacaatgaaaggcagaaccttcgattgc
ggcgataaactcggttatatgcaggcatttgtcgaatatagtttgcatcatcctaaatta
ggtgcggaattcaaaacttatttgaaacagctggcaactaagatttaa

DBGET integrated database retrieval system