KEGG   Gallibacterium anatis: UMN179_01577Help
Entry
UMN179_01577      CDS       T01482                                 

Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
gan  Gallibacterium anatis
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    UMN179_01577
  Lipid metabolism
   00600 Sphingolipid metabolism
    UMN179_01577
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    UMN179_01577
Enzymes [BR:gan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     UMN179_01577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1716451..1719489
Genome map
AA seq 1012 aa AA seqDB search
MPLQPSLDWLSDPSVFAVNRLTAHSDHSYYTSLAQAQRNAAMSMRHSLNGEWYFHYTKNP
QLQPQDFYQSDVDNRSWSTIRVPGHIQLQGFAQPHYVNTMYPWDGKADIRPPAIPQDENG
VGSYVTYFSVPTAWQSQPVFISFQGVETAFYLWLNGHFVGYSEDSFTPAEFELTPYLQTG
ENKLAVAVYQRSTGSWLEDQDFWRFSGIFRDVYLYTIPKIHLYDLEIKQHISENLQTAEI
LIKGQFSTHSENAKTVQITLCDQAGATLATTEQQLTTTTFSASLPVANPHLWSAESPYLY
QLYLQIFDRHHKLIEVIPQPVGLRRFEMKNGVMCLNGKRIMFKGVNRHEFHHQRGRAINE
QDMLADIQILKQHNINAVRTSHYPNQSRWYQLCDQYGIYLIDETNLETHGSWQKMGNVEP
SWNIPGNDLRWNACVLDRAKSMYERDKNHPSILIWSCGNESYAGEVLLNVANYFRQKDPQ
RLVHYEGVFHCREFDQISDIESRMYAKPHEIEQYLQQNPQKPYISCEFSHAMGNSNGNLH
KYIALEKYEKYQGGFIWDFIDQALLSKDRYGNDYLAYGGDFDDRPTDRNFCCNGLIFADR
TLSPKMQEVKFLYQNIKLYPQKDKVLIKNENLFIDTQNYYFVATLRLEGKIKKSYRFDAL
IAAQMERLMPLHWDEDDWLENGEYCVEVSVHLKQKTLWAAADSELGFGQFIVPQTAKVQD
TPITALQPLKMVVGDINVGVFGDHFSALFSRQEGSLISLKFGDKELIKTAPMPLFWRATT
DNDRGTNRRFKAGYWLMASLCGRCHKMDWQQHQDGGVSVSFDYIYPIYQQLKVTVTYDIQ
CNGEIKVHCHYFGEANLPNLPIFALSFRVDADYQHLRWYAMGEAENYQDRCSGAKLKIFE
NRVQDNDTPYTIPQECGNRTGVRWVECRQSTGGFKIEAIDKPLSCNFLPYTAFELEQAQH
HYELPPIHYTVVTIAAKQMGIGGDDSWGAEVHPEYCLPADGELSFAFVIKVV
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgcaaccgagtttagattggttatccgatccgtccgtttttgcggttaatcgt
ttaactgcacattccgatcacagctattataccagcttggcacaggcacaacgcaatgcc
gcaatgtcgatgcgtcattcgctaaacggtgagtggtattttcattacacgaaaaatcca
cagttacaaccacaagatttttatcaatcggacgtggataatcgcagttggtcgacaatt
cgtgtgccggggcatattcagctgcaaggctttgcacaaccgcattatgtcaatacgatg
tacccgtgggatggcaaggcggatattcgcccaccggcaattccgcaagacgaaaacggt
gtcggcagttatgttacctatttttccgtaccgactgcgtggcaatcacaaccggttttt
atctcttttcaaggggtggaaaccgccttttatctttggctcaacgggcattttgtcggt
tacagcgaagactcctttacaccggcggaatttgaattaaccccttatttgcaaaccggc
gaaaataaattggcagtggcggtataccaacgcagcaccggcagttggttggaagatcaa
gacttttggcgtttttccggtatttttcgtgatgtctatctttacaccattccaaaaatc
cacctctatgatttggagattaaacaacatatttctgaaaacttgcaaacagcggaaatt
ctgatcaaaggacaattttcaacacacagtgaaaacgcaaaaacagtacaaataacgctg
tgcgatcaagcgggcgctacgcttgccaccaccgaacaacagctgacaacaacaaccttc
agtgcatccttgccggttgccaatccacatttatggagcgccgaatcgccctatctttat
cagctttatctccaaattttcgaccgacatcacaagttgattgaagtaatcccgcagccg
gtcggtttacgccgttttgaaatgaaaaacggcgtgatgtgcttgaatggaaaacgcatt
atgttcaaaggcgtcaatcgccacgaattccatcaccagcgcggacgtgcgatcaacgaa
caagatatgttggcagatattcaaattttgaaacaacacaatatcaatgcggtcagaaca
tcacactatcctaatcaaagtcgctggtatcaattgtgcgatcaatacggtatttatctg
atcgatgaaactaatcttgaaacgcacggatcgtggcaaaaaatgggtaacgttgaacca
tcgtggaatattccaggtaatgatttacgttggaatgcgtgcgtgttggatcgagcaaaa
tcaatgtatgaacgtgataaaaatcacccgtctatcttaatttggtcgtgtggtaatgaa
tcttatgcgggggaagtattgcttaatgttgccaattattttcggcaaaaagatccgcaa
cggttagtgcattatgaaggcgttttccattgtcgtgaattcgatcaaattagcgatata
gaaagccgaatgtatgccaagcctcacgaaattgaacaatatttgcaacaaaatccacaa
aaaccatatatcagttgtgaatttagtcacgcaatggggaattctaatggtaatttgcat
aaatatatagcattagaaaaatatgaaaaatatcaaggaggttttatttgggattttatc
gatcaagctttattaagtaaggatcgttacggtaatgattatttagcctatggcggtgat
tttgacgaccgaccaacagatcgtaatttctgctgtaacggtttgatctttgcagatcgt
actttatcgccgaaaatgcaggaggtgaaattcctctatcaaaatatcaaactctatccg
caaaaagataaagtattgatcaaaaatgaaaatctatttattgatacgcaaaattactat
tttgtggcaacgttacgcctcgaaggcaaaattaaaaaaagttaccgttttgatgctctt
attgcagcacaaatggaacgtctaatgccactacattgggatgaagacgattggcttgag
aacggtgaatattgcgtagaagtcagcgttcatttaaaacagaaaaccttgtgggcagca
gcagacagcgaattgggtttcgggcagtttattgttccgcaaactgccaaagtacaagac
acgccaatcaccgcattacaaccgctaaaaatggtagtgggcgatattaatgttggcgtg
tttggcgatcatttttctgcactgttttcacgacaagaaggtagcttaatttcattaaaa
ttcggtgataaagagttaattaaaaccgcaccaatgccgttattctggcgtgcaaccacc
gacaatgaccgtggcacaaacagacgttttaaagccggttattggttaatggcaagccta
tgcggacgctgtcataaaatggattggcaacagcatcaagacggcggtgttagtgtcagc
tttgattatatttatcctatttatcaacaacttaaagtaacggtaacatatgacattcaa
tgtaacggtgaaataaaagtgcattgtcattattttggagaagcaaacttgccgaattta
ccgatttttgcattaagttttcgcgttgatgcggattatcagcatttacgttggtatgcg
atgggtgaagcggaaaattatcaagatcgttgtagcggcgcaaaattgaaaatttttgaa
aaccgtgtccaagataacgacactccttacacgattccgcaagagtgcggaaaccgcacc
ggcgtgcgttgggtggagtgtcgtcaatcaacaggcggttttaaaatcgaagctatagat
aaaccgttatcttgcaatttcttgccttatactgcttttgaattggaacaggcacaacac
cattatgaattaccgccgatacattatacggtggtcaccatcgccgctaaacagatgggc
attggcggcgatgacagctggggtgcggaagtacatccggaatattgcctgccggcggat
ggtgaactctcttttgcttttgtaattaaggtagtgtag

DBGET integrated database retrieval system