KEGG   Gallibacterium anatis: UMN179_01652Help
Entry
UMN179_01652      CDS       T01482                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
gan  Gallibacterium anatis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    UMN179_01652
Enzymes [BR:gan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     UMN179_01652
Transfer RNA biogenesis [BR:gan03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    UMN179_01652
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1783244..1784047)
Genome map
AA seq 267 aa AA seqDB search
MKTLTTLLEQALTIAYQAGEQLTAFYHQNVHIKIKADQTPVTEADIAVSRFLVKALSELD
PTIPVLSEENCAIPLAERQQWQRYWLIDPLDGTQQFIDRTDQFSVLIALVENHQPVIGII
HAPVLAQTFYAAKGEGAFFVENGQKTRLLHQKPFDQQQPIKIAVGRSANQQKMLAALNPA
FQYQFITYGSSGLKSTLVARQQCDCYLRFGDTGEWDTAAAQVILQESGGDIFTIDHQPLS
YNRRETFVNPHFIAVGNRHWDWHKILL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattaaccactttgttggaacaggcattaaccattgcctatcaggcaggcgaa
cagctgacagcgttttatcatcagaatgtccatatcaaaattaaagccgatcaaacgccg
gtaacggaggcggatattgcggtaagtcggtttttagtcaaggcgttaagtgaattagat
ccgaccattccggtgttatcggaagaaaattgcgccattccgttagcggaacgccaacaa
tggcagcgttattggttgattgacccgttagacggcacgcaacaatttatcgatcgcacc
gatcaattttccgtattaatcgctttagtagaaaatcatcagccggttatcggcattatt
cacgcgccggtgttggcacagaccttttatgcggcaaaaggcgaaggcgcatttttcgtg
gaaaatgggcaaaaaacacgcttattgcatcaaaagccgtttgatcaacagcagccgatt
aagattgcagtcggcagaagtgcaaatcaacaaaaaatgttggcggcattaaatccggcg
tttcaatatcaatttatcacttacggttccagcggtttgaaaagcacgttggtagcacgc
caacagtgtgattgctatcttcgctttggcgataccggcgaatgggataccgccgccgca
caggtgattttgcaagagagcggtggcgatattttcacaatagatcatcaaccgttgagt
tataaccggcgagaaacctttgtcaatccgcattttatcgcggtgggaaaccgtcattgg
gattggcataagatcctgttgtaa

DBGET integrated database retrieval system