KEGG   Gallibacterium anatis: UMN179_01851Help
Entry
UMN179_01851      CDS       T01482                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
gan  Gallibacterium anatis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    UMN179_01851
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     UMN179_01851
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1998046..1998624
Genome map
AA seq 192 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYRERGMNTLVYTAAIDNRYGVGKVTSRIGIEEQAQ
LFDQQTDLFSEIERINQQQHLNCILVDEAQFLTKAQVYQLSEVVDKLNIPVLCYGLRTDF
QAELFEGSRYLLAWADQLEELKTICYCGRKANFVLRLNEQGEVIKEGDQIQIGGNDHYLS
VCRRHYKEKMGC
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttttattactcttcaatgaatgcgggaaaatcaaccactttattg
caatcttcttataattatcgcgagcgtggaatgaatacgttggtttataccgcagcaatc
gataatcgttatggtgttggcaaagtgacttcgcgcatcggcattgaagaacaggcgcaa
ctgtttgatcagcaaacggatttatttagtgaaattgaacgcattaatcaacagcaacat
ctcaactgtattttagtggatgaggcgcagtttttaactaaagcgcaggtctatcagctc
agtgaagtggtcgataaattaaatattccggtgttatgttatggcttaagaaccgatttt
caggcggaattatttgagggcagccgttatttgctggcgtgggcagatcagctggaggaa
ctaaaaaccatttgttactgtggtcgcaaagccaattttgtattacgcttaaatgagcaa
ggcgaagtcatcaaagagggtgatcagatccaaatcggtggtaatgatcactatttatcg
gtttgtcgtcgtcactataaagaaaaaatgggttgttaa

DBGET integrated database retrieval system