KEGG   Gallibacterium anatis: UMN179_01882Help
Entry
UMN179_01882      CDS       T01482                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
gan  Gallibacterium anatis
Brite
Enzymes [BR:gan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     UMN179_01882
Secretion system [BR:gan02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   UMN179_01882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2030433..2031116
Genome map
AA seq 227 aa AA seqDB search
MKKQLLALLALSMATTAFGDNAKIIAQLKKLGVEKVEVQDSPLNGLKAAVTDQGILYVSE
DGKYVLQGNLYQLTDSGAINLSNKLLAAQVENLKNEMIVYPAKKEKYVVTVFMDITCHYC
HILHEQLKQYNDLGITVRYLAFPRGGLSSQAAQQMESIWTDKDPAYALNEAEKGHLPTKM
KTPNIVSKHYQLGLQYGVRGTPSIILPSGELLGGYVPPQELLKILQE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagctattagcattgttggcactttctatggcgactaccgctttcggcgat
aacgccaaaattattgcgcaattaaagaaattgggcgttgaaaaagtggaggttcaagat
tcgccattaaatggcttgaaagcggcagttaccgatcaaggcattttatatgtttctgaa
gatggcaaatatgtattgcaaggtaatttatatcaattaaccgatagcggtgcgattaat
ctttccaataaattattggcagcacaagtagaaaatttaaaaaatgagatgattgtttat
ccggcaaaaaaagaaaaatatgttgttacggtatttatggatattacctgccattattgc
catattctgcacgaacagctgaaacaatataatgatttgggcattaccgtacgttattta
gctttcccaagaggtggattatccagccaagctgcacagcaaatggaaagtatttggacc
gataaagatccggcatatgcgttgaatgaagctgaaaaaggtcatttgccgaccaaaatg
aaaacgccgaatatcgtcagcaaacattaccaattaggtttacaatatggcgtgcgcggc
acaccgagtatcattttgcctagcggtgaattattgggaggttatgtgccgccgcaagag
ttgttaaaaatcttacaagagtaa

DBGET integrated database retrieval system