KEGG   Gallibacterium anatis: UMN179_01890Help
Entry
UMN179_01890      CDS       T01482                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gan  Gallibacterium anatis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    UMN179_01890
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UMN179_01890
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    UMN179_01890
Enzymes [BR:gan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     UMN179_01890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2039275..2040552
Genome map
AA seq 425 aa AA seqDB search
MNLYNIKHPEEKVNFSQAVRQGLGKDQGLFFPETLPHFDNVEALLALPLVERSQRILSAI
IGDEISAEQLANMVAKAFTFPAPLAKVEDHIYALELFHGPTLAFKDFGGRFMAQALATVR
KDGKITILTATSGDTGAAVAHAFYGLENIDVVILYPKGKISVLQEKLFCTLGGNIRTIAI
EGDFDACQALVKQAFDDQALREAIGLNSANSINISRLLAQICYYFEAVAQLPKAQRQNVV
VSVPSGNFGNLTAGLIAKAIGLPIKRFIAATNANDTVPRYLRSHQWQPNATVATLSNAMD
VSRPNNWPRVEELFRRENWSLNDLHSDSVTDAETEQTLKDMFAKGYLCEPHGAIAYRVLK
QDLQPGETGIFLCTAHPAKFKESVERILETEVALPEALAKHNALPLLSITMPADFDKLKS
FLLDK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatacaacatcaaacatccggaagagaaagtcaatttttcacaggcagtacgt
caagggctagggaaagatcaaggtctgttctttccggaaaccttaccgcattttgataat
gttgaagcgttgttggcattgcctttggtagaacgcagccaacgcattttatccgctatt
atcggtgatgaaattagtgctgagcagttagcaaatatggtggcgaaagcgtttaccttt
ccggcaccgctggctaaagtagaagatcatatttatgcattggagttgtttcacggcccg
accttggcatttaaggatttcggcggacgctttatggctcaagcattagcgactgttcgc
aaagatggcaaaatcactattttaacggcaacttcgggtgataccggcgccgcagtggca
cacgcattttatggattggaaaatattgatgtcgtcattctctatccgaaaggcaaaatc
agcgtgttgcaagaaaaattattctgcactttgggtggaaatattcgcactatcgccatt
gaaggagattttgatgcctgccaagcattggttaaacaagcttttgatgatcaggcattg
cgtgaagcgattggcttaaattctgccaattcaatcaatatcagccgtttattggctcaa
atttgttactattttgaagccgttgctcaattgccgaaagcgcaacgccaaaatgtagtg
gtttctgtgccgagcggtaatttcggtaatttaactgccggattaattgctaaagcgatc
ggcttaccgattaaacgttttattgccgcaaccaatgctaatgacactgtaccgcgttat
ttgcgttctcatcagtggcaaccgaatgccaccgtggcaactttatccaatgcaatggat
gtgagtcgtccgaataactggccgcgtgttgaagagttattccgccgtgaaaactggtcc
ttaaatgacttgcattccgatagtgtaaccgatgctgaaaccgagcagacattgaaggat
atgtttgcaaaaggttatctctgcgaaccgcacggtgctatcgcttatcgagtgctgaaa
caggatttacaaccgggagaaaccggtattttcctttgcactgcgcatccggcaaaattt
aaagagagtgtcgaacgtattttagagactgaagtggcattaccggaagcattggctaaa
cataacgccttaccgttattatcaatcacaatgccggcagattttgataagttgaaatcg
tttttgttggataaatga

DBGET integrated database retrieval system