KEGG   Gallibacterium anatis: UMN179_01995Help
Entry
UMN179_01995      CDS       T01482                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
gan  Gallibacterium anatis
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UMN179_01995
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    UMN179_01995
Enzymes [BR:gan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     UMN179_01995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2155943..2156974
Genome map
AA seq 343 aa AA seqDB search
MSKLIVDLQGKSVEAEEIEILNHPLIAGVILFSRNFEDIPQLQHLIETIRQKVKRPLLIC
VDQEGGRVQRFRNGFTQLPAMQAFSALLAQEEQQYWAQESAWLMASEMIAMDIDLSFAPV
LDVGHQCKAIGDRSFHQDWRQLLPLAEAFCDGMLQAGMATTGKHFPGHGHVIADSHLETP
RDERPFAQIQQQDLQPFQQLIEKQKLNAIMPAHVIYTQADTQPASGSSFWLKQVLRQQLG
FKGIIFSDDLGMKGAGAMGGFVERSQQALAAGCDILLLCNERAGVIDVLDRLQYQPTVQE
KTAYLQLTKKKTFSLSQLQASERWLKAHHFLSALQQKWLEVKG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaattaatcgttgatttacaaggtaaatcagtagaggcggaagagattgaaatt
cttaatcatccgttaattgccggtgttattctgttttcgcgtaattttgaagatattccg
caattgcagcatttaattgaaaccatccgacaaaaagtaaaacgcccactattgatttgc
gttgatcaggagggaggcagagttcagcgttttcgtaacggatttacgcaattaccggca
atgcaagcgtttagtgcattattggcgcaagaggaacaacaatattgggcgcaagagagt
gcgtggttaatggcatccgaaatgattgcaatggatattgatttaagttttgccccggtt
ttggatgtcggtcatcaatgtaaagcgatcggagatcgcagttttcatcaggattggcga
cagttattgccgttagcggaagctttttgtgacggtatgttgcaggcaggaatggcaacg
acaggcaaacattttccagggcacggacacgttattgccgattcgcatttggaaacacca
agggatgaacgcccttttgcccagattcaacagcaagatttgcaaccgttccagcaatta
attgaaaaacagaaattgaatgcaattatgccggcacacgtgatttatactcaggcagat
acacaaccggcaagtggttcaagtttttggttaaaacaggtgttaagacaacagcttggt
tttaaagggattattttttctgatgatttaggaatgaaaggtgccggtgcgatgggcggt
tttgtcgaacggagccaacaggcattggcggcaggttgcgatattctactattatgcaat
gaacgtgccggtgtgattgacgtgctggatcggctgcaatatcaaccgacagtgcaggaa
aaaacagcttatttacaattaacgaagaaaaaaacgttttcattatctcaattacaagcc
agtgagcgttggctaaaagcgcaccactttttgtctgcattacaacagaaatggttagag
gtaaaaggctga

DBGET integrated database retrieval system