KEGG   Gallibacterium anatis: UMN179_02014Help
Entry
UMN179_02014      CDS       T01482                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gan  Gallibacterium anatis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:gan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    UMN179_02014
DNA repair and recombination proteins [BR:gan03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      UMN179_02014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2174549..2175151
Genome map
AA seq 200 aa AA seqDB search
MQISPLLDELMDALRCLPGVGPKSAQRMAYYLLQRDRSGAMNLAKTLTEAMAHIGHCSQC
RTFTEEEVCNICNNYRRQENGQLCIVEMPSDIQAIEQTGQFSGRYFVLMGHLSPLDGIGP
KEIGLDLLQKRLQTESFSEVILATNPTIEGDATANYIAEMCQQYGVKVSRIAHGIPVGGE
LEMVDGTTLSHSFIGRRELK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattagccctttacttgatgaattgatggatgctttgcgttgcctgccgggagtc
ggcccgaaatcagcacaacgaatggcatattatttattacagcgtgatcgcagcggcgca
atgaatttggctaaaacgctgacagaagcgatggcgcatatcggtcattgcagtcaatgt
cgcacttttaccgaagaagaagtgtgtaatatttgtaataactatcgccgtcaagagaat
gggcagttatgcatagtggaaatgccttctgatattcaggcaattgaacagacagggcag
ttttcaggtcgttattttgtattaatggggcatttatcgccattggatggtatcgggccg
aaagagattgggctggatttattgcagaaaagattgcagacagaatctttttctgaagtg
attttagcgactaatccaacgattgaaggtgatgccacagcgaattatattgcggaaatg
tgtcaacagtatggggtaaaagtgagccgtattgctcacggtattccggttggcggtgaa
ttggaaatggtggacggtacaacgttatcgcactcgtttattggcagacgagaattaaag
tag

DBGET integrated database retrieval system