KEGG   Gallibacterium anatis: UMN179_02076Help
Entry
UMN179_02076      CDS       T01482                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gan  Gallibacterium anatis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    UMN179_02076
   01230 Biosynthesis of amino acids
    UMN179_02076
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN179_02076
   00030 Pentose phosphate pathway
    UMN179_02076
   00051 Fructose and mannose metabolism
    UMN179_02076
   00052 Galactose metabolism
    UMN179_02076
  Energy metabolism
   00680 Methane metabolism
    UMN179_02076
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     UMN179_02076
Protein phosphatases and associated proteins [BR:gan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     UMN179_02076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2230991..2231956
Genome map
AA seq 321 aa AA seqDB search
MIKKIAVLTSGGDAPGMNAAIRGVVRATLYEGLEVYGVYDGYQGLYFNKIKKLERFSVSD
VINRGGTFLGSARFPEFKDPSVRAKCVENLRFHGIDALVVIGGDGSYMGAKLLTEEHDFP
CIGLPGTIDNDVAGTDYTIGYQTALETAVDAIDRLRDTSSSHQRISIVEIMGRHCGDLTL
AAAIAGGCEFIVIPERPFEREALIRKVEYGIEKGKRHAIIAITEHMCDVNELAKEIEERV
HHETRATVLGHIQRGGAPCAFDRILASRMGVYAVELLLQGEKGRCVGIQNEQLVHHDIID
AIQNMKRSFKEDWFNTSRKLY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaattgccgtattaacaagtggtggtgatgcaccgggaatgaatgccgcg
atccgtggtgtagttcgtgcaactctatacgaagggttggaagtttatggagtttatgac
ggataccaaggattatattttaataaaatcaaaaaattggaacgtttcagtgtttctgat
gtgattaatcgtggcggtacattcttaggttcagcacgtttcccggaattcaaagatcct
tcagtacgtgcaaaatgtgttgaaaatttacgttttcacggtattgatgcccttgttgtt
attggcggtgacggttcctatatgggggcaaaattattaactgaagaacacgatttccct
tgtatcggcttgcctggcacaattgataatgatgttgccggtaccgattatactatcggt
tatcaaacagcattagaaacagcagtggatgcgattgaccgtttacgtgatacttcaagt
tcccaccaacgtatctctatcgtggaaattatggggcgacattgtggtgatttaacttta
gcagcagcgattgctggaggttgcgaatttatcgtgattccggaacgcccttttgaacgc
gaagcattaattcgtaaagtggaatatggtattgaaaaaggtaaacgccacgccattatt
gcgattactgagcatatgtgtgacgttaacgagttagcgaaagagattgaagaacgtgtt
catcacgaaactcgtgcgacagtattgggacatattcaacgcggcggtgcgccttgtgcc
tttgaccgtattttggcttccagaatgggagtttatgcggtcgaattattattgcaaggt
gaaaaaggtcgttgtgtcggtatccaaaatgaacagctcgttcaccacgatattattgat
gctattcaaaatatgaaacgtagctttaaagaagattggttcaatacctcaagaaaactt
tattaa

DBGET integrated database retrieval system