KEGG   Gallibacterium anatis: UMN179_02146Help
Entry
UMN179_02146      CDS       T01482                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
gan  Gallibacterium anatis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    UMN179_02146
   00052 Galactose metabolism
    UMN179_02146
   00500 Starch and sucrose metabolism
    UMN179_02146
   00520 Amino sugar and nucleotide sugar metabolism
    UMN179_02146
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     UMN179_02146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2303279..2303878
Genome map
AA seq 199 aa AA seqDB search
MSSATFTFTRQGEMLGLGHAVLVGKELVGEEPFAVVLADDLCINEDGPGVLAQMAKLFNQ
FRCTIVAVQEVPESETHKYGVIRGTQLSDDLYRVEDMVEKPEPGKAPSNLAIIGRYILTP
DIFDLIKNTPAGKNGEIQITDALLQQAKNGCVIAYKFKGKRFDCGSVEGFIEATNYCYKN
IYLKETDIKLAKENTHKIK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagttcggcaacctttacatttactcgccaaggtgaaatgttaggtttaggacatgct
gttttagttggtaaagagttagtgggtgaagaaccgtttgcagttgtgttggcggatgat
ctttgtattaatgaagatggaccgggtgtattggcgcaaatggcaaaactttttaaccag
ttcagatgtactattgttgcggttcaagaagtgccggaaagtgaaacacataaatatggt
gtgattagaggaacacaattaagcgatgatttatatcgtgttgaagatatggtggaaaaa
ccggaaccgggcaaagcaccgagtaatttagcgattattggtcgttatattttgactccg
gatatttttgatttaattaaaaatacgcctgcaggtaaaaatggagaaatccaaattaca
gatgcactattgcaacaagcaaaaaacggttgtgtgattgcatataaattcaaaggtaaa
agatttgattgcggtagtgtagagggctttattgaagcaacaaattattgttataaaaat
atctatttaaaagaaacagatattaaattagcaaaagaaaatacgcataagataaagtaa

DBGET integrated database retrieval system