KEGG   Gallibacterium anatis: UMN179_02193Help
Entry
UMN179_02193      CDS       T01482                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
gan  Gallibacterium anatis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    UMN179_02193
   00240 Pyrimidine metabolism
    UMN179_02193
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    UMN179_02193
   03430 Mismatch repair
    UMN179_02193
   03440 Homologous recombination
    UMN179_02193
Enzymes [BR:gan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     UMN179_02193
DNA replication proteins [BR:gan03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     UMN179_02193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2362287..2362721)
Genome map
AA seq 144 aa AA seqDB search
MINRRELLLQEMGITLWQLVHPEVLQGVGIINVPANIHTIILSEQHSITASQLIQDLLRA
AETTADKALIINSQQLQRLESDHPLLVFCVEDCLPQFQNSALAKIATQIISLNSTLTLSV
QQKRTIWQQIRHFLQNENTISNHH
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgataaacagacgagaattgttactgcaagaaatgggcattaccctttggcaattagta
catcctgaagtgttacagggtgtaggtatcattaatgtaccggctaacattcataccatt
attctgtcagaacagcactcaataacagcgtcacagttaatccaagatttattacgtgcg
gcagaaacaactgctgataaagccttaattataaacagtcaacaattacaacgtttagag
agcgatcatccactgcttgtgttttgtgttgaagattgtttaccacaatttcaaaactca
gcattagccaaaattgccacacaaatcatttcattaaattcaacattaaccttgtccgtt
caacaaaaacgcacaatttggcaacaaatccggcactttttacaaaatgaaaacacaatt
tcaaaccatcactga

DBGET integrated database retrieval system