KEGG   Gallibacterium anatis: UMN179_02193Help
Entry
UMN179_02193      CDS       T01482                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
gan  Gallibacterium anatis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:gan00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:gan00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:gan03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:gan03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gan03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2362287..2362721)
Genome map
AA seq 144 aa AA seqDB search
MINRRELLLQEMGITLWQLVHPEVLQGVGIINVPANIHTIILSEQHSITASQLIQDLLRA
AETTADKALIINSQQLQRLESDHPLLVFCVEDCLPQFQNSALAKIATQIISLNSTLTLSV
QQKRTIWQQIRHFLQNENTISNHH
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgataaacagacgagaattgttactgcaagaaatgggcattaccctttggcaattagta
catcctgaagtgttacagggtgtaggtatcattaatgtaccggctaacattcataccatt
attctgtcagaacagcactcaataacagcgtcacagttaatccaagatttattacgtgcg
gcagaaacaactgctgataaagccttaattataaacagtcaacaattacaacgtttagag
agcgatcatccactgcttgtgttttgtgttgaagattgtttaccacaatttcaaaactca
gcattagccaaaattgccacacaaatcatttcattaaattcaacattaaccttgtccgtt
caacaaaaacgcacaatttggcaacaaatccggcactttttacaaaatgaaaacacaatt
tcaaaccatcactga

DBGET integrated database retrieval system