KEGG   Gallibacterium anatis: UMN179_02212Help
Entry
UMN179_02212      CDS       T01482                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
gan  Gallibacterium anatis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UMN179_02212
Enzymes [BR:gan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     UMN179_02212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2383403..2384161
Genome map
AA seq 252 aa AA seqDB search
MGILVTRPEDAGQHLTEMLNKVGVAAIYAPFIKIEAGEQLNDVPQKLQQLAAGDYVISVS
QYAVQYAHQVLQNTGFGWRKDVHYFAVGRKTAALLSEATQQPAHYPFANENSEGLLALPQ
MQNCNGRRVIILRGQSGRELLPQQLPQRGAAVETVACYCRQAQQLSEAELKFFSRAGIDT
IVITSGEILRYLLDFIPKSEHNWLMSCKLVVISDRLMQLALEAGWQQDKIILTEKADNLS
LLKTILSFYPHS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgggtattttggtcacaagaccggaagatgccggtcagcatttaacagaaatgttaaat
aaagtgggcgtagcagcaatttatgcgcctttcattaaaattgaagccggcgaacagtta
aatgatgtaccgcaaaaattgcaacagctcgctgccggtgattatgtgatctctgtttcg
caatatgcagtgcaatatgctcatcaagtgttgcagaataccgggtttggttggcgtaaa
gatgtgcactattttgcagtagggcggaaaacggcggcactgttaagtgaagcaacgcaa
caaccggcgcattatccatttgccaatgaaaatagtgagggtttattggcattgccgcaa
atgcaaaattgtaacgggcgacgtgttattattttgcgagggcagagcggtcgcgaatta
ttaccacaacagttgccgcaacgtggtgcagcagtggaaacagtggcgtgttattgtcgt
caggcacagcaattaagtgaagctgaattgaaatttttttcgcgtgccggaattgatacg
attgtgataaccagcggtgaaattttgcggtatttactggattttattccaaaaagtgaa
cataattggctaatgagttgtaagttggtggtgattagtgatcgtctgatgcagcttgcg
ttggaggcaggttggcaacaggataagattattctcactgaaaaggctgataatcttagt
ttattaaaaacaatattatccttttatccccattcttga

DBGET integrated database retrieval system