KEGG   Gallibacterium anatis: UMN179_02229Help
Entry
UMN179_02229      CDS       T01482                                 

Definition
aldose-1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
gan  Gallibacterium anatis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:gan00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2401260..2402087
Genome map
AA seq 275 aa AA seqDB search
MTFSLLNKMQFIEQIHPNISLQRYNEISMIVVEHESGRAIVSLQGAQLLSWQPKYAAQDL
LWLSDAEPFKQGVAIRGGMPICYPWFGANGEPAHGFARLRQWVLSDWQVSEHEVKLIFGL
YSENNIAIARVRMSFSEDCRVKFTQLDNSEAQVALHTYFNIGDIEQTTIFGLPKHCFDSA
AKEEIDVASPLSIRQHTDYIYSGENRINHIEDKANARFIEVEHHNASNVVVWNPWHKATS
AMSEQGYRTMLCVETARIDQKIKQGDAIEVRIAQQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacattttcgctgttaaacaaaatgcagtttattgaacagatccatccgaatatttcg
ctacaacgctacaatgaaatttcaatgattgtggtggagcacgagagcggtcgggcgatt
gtttcgttacagggcgcgcagttattaagttggcaacctaaatatgcggcgcaggatcta
ttatggttgagcgatgctgaaccttttaaacagggggtggcaattcgtggcggtatgccg
atctgttatccgtggtttggtgcaaatggcgaaccggcacacggttttgcgcgcttgcgt
caatgggtgctaagtgattggcaagtgtctgaacacgaagtgaagttaatttttggcttg
tattctgaaaataatattgcgattgctcgagtgagaatgtcattttccgaagactgccgt
gttaaatttacgcaattagataacagtgaagcacaagtggcgttgcatacctattttaat
atcggtgatattgagcaaacgacgattttcggcttgccaaaacattgctttgattcggca
gccaaagaggagattgatgtggcatcgccattgtctattcgtcagcatacagattatatc
tattccggcgaaaaccgtattaatcatatcgaagataaagcgaatgcccgttttattgag
gtggaacaccataatgcgagcaatgtggtggtgtggaatccgtggcacaaagccaccagt
gcaatgagtgaacagggatatcgcacaatgctttgtgtggaaaccgcacgaatcgatcaa
aagattaaacagggcgatgccattgaagtgcggattgcacagcaataa

DBGET integrated database retrieval system