KEGG   Gallibacterium anatis: UMN179_02469Help
Entry
UMN179_02469      CDS       T01482                                 

Definition
(GenBank) short chain dehydrogenase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
gan  Gallibacterium anatis
Pathway
gan00670  One carbon pool by folate
gan00790  Folate biosynthesis
gan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UMN179_02469
   00670 One carbon pool by folate
    UMN179_02469
Enzymes [BR:gan01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     UMN179_02469
    1.5.1.50  dihydromonapterin reductase
     UMN179_02469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase KR RmlD_sub_bind BetaGal_dom3
Motif
Other DBs
NCBI-ProteinID: AEC18476
UniProt: F4H9M3
Position
complement(2637017..2637739)
Genome map
AA seq 240 aa AA seqDB search
MKDAIIITGAGRRVGYVLAQHFAKKGENVVISYRHTYHQLTQLPKSVLQLQADFSELNNI
ERFVSQIKTHCESVKAVIHNASAWQAEQNADILQDSRLFQALMRIHAELPYLLNRQLFPL
LHASAQQRQATSDIIHITDFVAYKGSQKHLAYAASKAALENLTLSFAAQYAPLVKVNSIA
PSLIMFNENDSAEYQQKALQKSVMQKIGGYEEMIKAVEYLFSSQYITGETIKITGGRHLK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgccattatcatcaccggtgccggtcggcgtgtcggctatgttttagcacag
catttcgccaaaaagggggaaaatgtcgtaatctcttatcggcacacttatcatcagctg
actcaactgccgaagagtgtgttacaactacaagctgacttttctgaattgaataatatt
gaacgctttgtatcacagataaaaacacattgtgaatccgttaaagccgttattcataat
gcttctgcttggcaagcggagcaaaacgcagatattttgcaagatagccggttatttcaa
gctttaatgcgtattcacgctgaattgccttatctactaaatcgtcaactctttccttta
ttacacgcatcagcgcaacaacgtcaagcaacatcagacatcattcatattaccgatttt
gtcgcttacaaaggaagccaaaaacatcttgcttatgctgccagcaaagccgcattagaa
aatttgaccctctcttttgcagctcaatatgcaccgctagtaaaagtgaacagcattgcc
ccttctttaattatgtttaatgaaaatgatagtgcagaatatcagcaaaaagcattgcaa
aaatcagtaatgcaaaaaataggcggttatgaagagatgattaaagcggtcgaatacctc
ttttcaagccaatatattaccggagaaaccattaaaataaccggcggcaggcatttaaaa
tag

DBGET integrated database retrieval system