KEGG   Gallibacterium anatis: UMN179_02469Help
Entry
UMN179_02469      CDS       T01482                                 

Definition
short chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
gan  Gallibacterium anatis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:gan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    UMN179_02469
   00670 One carbon pool by folate
    UMN179_02469
Enzymes [BR:gan01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     UMN179_02469
    1.5.1.-  
     UMN179_02469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2637017..2637739)
Genome map
AA seq 240 aa AA seqDB search
MKDAIIITGAGRRVGYVLAQHFAKKGENVVISYRHTYHQLTQLPKSVLQLQADFSELNNI
ERFVSQIKTHCESVKAVIHNASAWQAEQNADILQDSRLFQALMRIHAELPYLLNRQLFPL
LHASAQQRQATSDIIHITDFVAYKGSQKHLAYAASKAALENLTLSFAAQYAPLVKVNSIA
PSLIMFNENDSAEYQQKALQKSVMQKIGGYEEMIKAVEYLFSSQYITGETIKITGGRHLK
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgccattatcatcaccggtgccggtcggcgtgtcggctatgttttagcacag
catttcgccaaaaagggggaaaatgtcgtaatctcttatcggcacacttatcatcagctg
actcaactgccgaagagtgtgttacaactacaagctgacttttctgaattgaataatatt
gaacgctttgtatcacagataaaaacacattgtgaatccgttaaagccgttattcataat
gcttctgcttggcaagcggagcaaaacgcagatattttgcaagatagccggttatttcaa
gctttaatgcgtattcacgctgaattgccttatctactaaatcgtcaactctttccttta
ttacacgcatcagcgcaacaacgtcaagcaacatcagacatcattcatattaccgatttt
gtcgcttacaaaggaagccaaaaacatcttgcttatgctgccagcaaagccgcattagaa
aatttgaccctctcttttgcagctcaatatgcaccgctagtaaaagtgaacagcattgcc
ccttctttaattatgtttaatgaaaatgatagtgcagaatatcagcaaaaagcattgcaa
aaatcagtaatgcaaaaaataggcggttatgaagagatgattaaagcggtcgaatacctc
ttttcaagccaatatattaccggagaaaccattaaaataaccggcggcaggcatttaaaa
tag

DBGET integrated database retrieval system