KEGG   Gallibacterium anatis: UMN179_02494Help
Entry
UMN179_02494      CDS       T01482                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
gan  Gallibacterium anatis
Brite
Enzymes [BR:gan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     UMN179_02494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2661349..2661870
Genome map
AA seq 173 aa AA seqDB search
MLKRVAGGICSVAAVIALLLLNSGDELRTSAAGLELIGNAEGCRTQPYYCSANVLTVGIG
SSELSGQAIEQRQYSLQEIANRWKQDIKQAETCVNRYANGKKMPQGAFDALVSITFNVGC
SAMRKSTLYKMANGGYTPQMCDQFLRWVYVGGKKSNGLMQRRDRERKLCLSGY
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaagggtggcaggcggtatctgttcagtggcggcagtgattgcccttctgttg
ctgaacagtggtgatgaattgagaacaagcgcagccggattggaattaatcggcaatgca
gaggggtgcagaacacaaccttattactgttccgctaatgtgttgacggttggtattggc
agcagtgagttaagcggtcaagcgattgaacagcgacaatacagcttgcaggagattgcc
aacagatggaagcaggatattaaacaggcggaaacgtgtgtcaatcgttacgccaacggc
aaaaaaatgccgcaaggggcgtttgatgcgttggtttccatcacctttaatgtcggttgc
agtgcgatgcgcaaatcaaccttgtacaaaatggcaaacggtggttatacaccgcaaatg
tgcgatcagtttttaaggtgggtttatgtcggcggtaaaaagtcgaacggtttaatgcag
cgacgtgatcgggaacgtaaattatgtttatcaggctattaa

DBGET integrated database retrieval system