KEGG   Gilliamella apicola: GAPWK_2387Help
Entry
GAPWK_2387        CDS       T03066                                 

Definition
Phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
gap  Gilliamella apicola
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gap00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GAPWK_2387
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    GAPWK_2387
  Energy metabolism
   00680 Methane metabolism
    GAPWK_2387
Enzymes [BR:gap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     GAPWK_2387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2672199..2674805
Genome map
AA seq 868 aa AA seqDB search
MLGTLLGDAIKRATGNDTFDLVEQIRQLSKSAQQGNKQAHNKLLKLIENLNDEDLLHVAR
AFNQFLNLVNTAAEYYGISPHGEASSSPKKMTELFSTLKNLNFSNQTITQAINDLSIELV
LTAHPTEINRRTMINTYTAINSCLSQLDHDDLADYEIERIMRRLKQLVCQAWYTDEIRKK
RPTPLDEAKWGFSVIEDSLWEGVPLFLREFNDQLVDAFNEQLSVEHVPIKFTSWMGGDRD
GNPNVTAKVTEKVMLQARLKAIELFLADIQILVRELSMTECSQSVIDLLDENNKAATEPY
RAVMKQLRARLVKTHSFIVSLLNNEQVLPPADILIKNEQLWGPLYTCYESLIENGMSTIA
HGPLLDTLRRIKNFGLQLVRLDIRQDSSVHTEALDALTKELNLGSYAEWSEEEKQAFLLT
ELQSNRPLLPYHWQPNEMVQEVLDTCRVIKKAGEESIASYVISMAKAPSDILAVYLLLKI
VDCQKVIPVAPLFETLDDLNNAKTVMQKLLDIPWYREKIHGKQMVMIGYSDSAKDAGTLA
ASWAQYRSQEELVKLFEKYNINLVLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTE
QGEMIRFKLGLPEVALSSLMLYASAILQANLLPPPEPKQNWRDIMDEMSDISCRCYRSYI
RERSEFVDYFRAVTPETELGRLPLGSRPQKRRTGGGIESLRAIPWIFAWTQNRLMVPSWL
GAGTALKQVIEKGNKNLLKDMYHNWPFFNARLGMLEMVYAKAAPNIHEYYEQRLVDPALW
PLGEELRNLLTQDINTVLTITDDISLMADLPWIAESVALRNTYIEPLNLLQAELLSRSRN
RNEDENSNVEQGLMITISGIAAGMRNSG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgctaggtactttactaggtgatgcaattaaacgggctacaggtaacgatacttttgac
ttagttgaacaaatcagacaattatcaaaatcagctcaacaaggtaataagcaagctcat
aataagttacttaaactgattgaaaatcttaatgatgaagatttattacatgtggctcgt
gcatttaatcagttcttaaatttagttaacaccgcagcagaatattatggaatatcccca
catggtgaagcatcaagtagccctaaaaaaatgacagaactgtttagtactttaaaaaat
cttaatttttcaaatcagacgatcactcaagccattaatgatctttcgattgaacttgtg
ttaactgcacatccaacagagatcaatcgccgaaccatgataaatacttatacagcgatt
aatagctgtctatcgcaacttgatcacgacgatttagcagattatgaaatagagcgaatt
atgcgtcgtttgaagcagttagtttgtcaagcatggtacaccgatgagattcgtaaaaaa
agaccaacgccactggatgaagctaaatggggcttttcggttattgaagatagtctttgg
gaaggggtaccactctttttgcgcgaatttaatgatcagttagtcgatgcatttaatgaa
caattatccgttgagcatgtaccaattaaatttacttcgtggatgggtggtgatcgcgat
ggcaaccctaatgtaacagcaaaagtgactgaaaaagttatgttgcaagctagattaaaa
gcaattgaactttttttagcggatattcaaattctggttcgtgaattatccatgactgag
tgcagtcaatctgtcatcgatctattagatgaaaataataaagctgcaactgaaccttat
cgcgcggtaatgaaacaactgcgtgcacgtttagtaaaaactcacagttttatagtgtca
ttattaaataacgaacaagtattacccccagcggatattttaattaaaaacgaacaatta
tggggaccactctatacatgttatgaatcattaatcgaaaatggcatgtcaacgattgca
catggaccactgcttgatactttgcgacgtataaaaaattttggtctgcaactggttaga
ttagacatccgacaagatagttccgtacacacagaagcactggatgcattaaccaaagaa
cttaacttaggcagttatgccgagtggtcagaagaagaaaaacaggcttttttgttaact
gaacttcaatcaaatcgtccactgttaccttaccattggcaaccaaatgaaatggttcaa
gaagttttagatacctgtcgagttattaaaaaggctggtgaagaatccattgcttcatac
gttatatcaatggccaaagcaccttcagacatcttggctgtttacttattattaaaaata
gttgactgtcaaaaggtaattcctgtagcgccattatttgaaaccttagacgatttaaat
aatgccaagacagttatgcaaaaactgcttgatattccatggtatcgcgaaaagattcat
ggcaagcaaatggttatgattggctattctgattcagctaaagacgcaggaacgcttgct
gcatcatgggctcagtatcgttcacaagaagagttagttaaattattcgaaaaatataat
attaatttagttttatttcatggtcgtggtggctcaattggtcgtggtggtgcgccagca
catgccgcattattatctcaaccgcctgggtcattgaaaggagggcttcgagtcaccgaa
caaggtgaaatgattcgttttaaactcggtttacctgaagtagcactcagcagtttgatg
ttatatgcctcagccattttgcaagctaatttattaccaccacctgaacctaaacaaaac
tggcgggatattatggacgaaatgtctgatatctcttgtcgttgttatcgtagttacatt
cgtgaacgttctgaatttgtcgattattttagagcagtaacaccagaaactgaattaggt
agattaccactcggttctcgtccacaaaaaagacgaacaggaggcggtattgaaagttta
agagccattccatggatttttgcttggacacaaaaccgtttgatggttccttcttggctc
ggtgcaggaacagcactcaaacaagttatcgaaaaaggtaacaaaaatctacttaaagac
atgtatcataattggcctttctttaatgctcgcctaggtatgctcgaaatggtgtacgca
aaagcagcaccaaatatccatgaatattatgagcaaagacttgttgatcctgccttatgg
ccgttaggagaagagttaagaaatctattaacgcaagatatcaacacggtactcactatc
actgatgatatcagtttgatggccgatctaccctggattgcagaatctgttgcattacgt
aatacctacattgagccactaaatttattacaggctgaattattaagtcgttcgcgtaat
cgtaatgaggatgaaaatagtaacgttgaacaaggattaatgatcaccatctctggtatt
gcggcaggtatgcgtaactcaggatag

DBGET integrated database retrieval system