KEGG   Gemmatimonas aurantiaca: GAU_0139Help
Entry
GAU_0139          CDS       T00878                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GAU_0139 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    GAU_0139 (hisD)
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     GAU_0139 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(168389..170839)
Genome map
AA seq 816 aa AA seqDB search
MDTDLPLRARGSWDRLDNATRRALEDRASTVDPTIRERTSAVIDAVRRTGDAALIDMARR
FDGATLETLEVPRAEWDRALAALDPALRQSLERAARNIATVHRAFLPTITRSTPEPGITV
VRRPDPLGRVGIYAPGGRAAYPSSLLMGAVPARVAGVGEIIVCTPPGPDGRPADVVLAAA
ALANVDRVFAVGGAGAIAAMALGTASVPRVDRIMGPGNAYVAEAKLQLVSAVAIDAPAGP
SELLVLADASADANTIAREMLAQAEHDPDAAVLAVIVDHSATSSLATRVETALQTQLASA
PRADVMRAALGARGGVVHMTSMDEAITFANRWAAEHLLLLVDDTQRDRVLAALRNAGTIF
VGASSSVAFGDYMTGANHVLPTAGAARSYSGLSTLDFVRWTTWQEVTPAAAASLSADVGR
FADAEGLPAHAATARTWQTATPVVPANTQPPAASADRAQMPDAVTDRLRFARALYDDVPL
YDPKRAPVSLDLTDNTNLWGMPPVAEHTWRSMPVARVTRYPSLYAAELKEALATFAGASP
DRLVTGCGSDDILDSAMRAFGEPGSVVASSEPSFAMIPIFARMNGLRYVGIAERADQQPD
LDALLAANPRILYLCSPNNPTGAVLARELLERAVREAPGVVFLDEAYAEFAGVSAVDLAM
RVDNLLVIRTMSKAFGLAGLRVGYGIGAPALVRDVEKSRGPYKLNAMAEQTALAALQHDM
AWVREHVALAVQNRERLAQALVQRGYTPLPSHANYLCVPVSNAVAVGQAMRARGVAARPF
PALPHVGDTLRISVGPWPLLEQLLTAFDDATQEVNG
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
gtggacaccgacctgccgttgcgtgcccgtggatcatgggaccgtctcgacaacgccacc
cgacgcgccctggaagatcgtgcctccaccgtggaccccacgattcgcgagcgcacgagt
gccgtgatcgatgcggtgcgccgcaccggcgacgccgcgctgatcgacatggcccgtcgc
ttcgatggcgccacgctcgagacgctcgaagtgccacgggccgaatgggatcgtgcgctc
gccgctctcgatccggcactgcggcaatcgctggaacgcgcggcccgcaacatcgccacg
gtgcatcgtgcgttcctgcccaccatcacccgcagcacaccggagcccggcatcacggtg
gtgcgtcgtcccgatccgctcggtcgtgtgggcatctacgcgccggggggacgcgcggcg
tatcccagctcgctgttgatgggtgccgtccccgcacgcgtggccggcgtcggcgaaatc
atcgtgtgcacaccaccgggtcccgacggacgtcctgcggatgtggtactggcggcggcg
gcgctggccaatgtggatcgggtgtttgccgtgggcggcgctggagcaatcgccgcgatg
gcgctgggcacagcgtcggtgccccgcgtggatcgcatcatgggtccaggcaatgcgtac
gtggccgaagccaagctgcagctcgtgtcggcggtggccatcgatgcaccggccggcccc
agcgagctgctggtcctcgccgacgcatcggccgatgccaataccatcgcgcgagaaatg
ctggcacaggcagagcacgaccccgatgcggccgtgctggcggtgattgtcgaccattcg
gccacgtcatcgctggcgacacgcgtggaaacggcgctgcagacgcagctcgccagcgca
ccgcgcgccgatgtcatgcgcgcggcactgggcgcccgtggcggcgtcgtgcacatgact
tcgatggatgaagccatcaccttcgccaatcgctgggcggccgaacacctgctgctgctg
gtcgacgacacgcagcgcgatcgtgtgctcgccgcgctgcgcaatgccggtacgatcttc
gtgggcgcatcgagctcggtggccttcggtgactatatgaccggtgccaatcacgtgctg
ccgaccgcaggagcggcgcgcagttactccggattgtccacgctggatttcgtgcgctgg
accacgtggcaggaagtcacgccagcggccgccgcgtcgctgtctgccgacgtgggacgg
tttgcggatgcggaaggcctgccggcgcatgcggcaacggcccgcacctggcagacggcc
acgccagtggtgcccgcgaacacacaaccgcccgccgcctcggcggaccgtgcgcaaatg
cctgacgcagtgaccgatcgcctgcggtttgcgcgggctttgtatgacgacgtgccattg
tacgaccccaagcgcgcaccggtgtcactcgatctcaccgacaacaccaacttgtggggc
atgccacccgttgccgagcacacatggcgcagcatgccagtggcgcgcgtgacacgatat
ccgtcgctgtacgcggcagaactcaaggaggcactggccacgtttgccggcgcatcgcca
gaccgcctcgtcaccggctgtggttcggacgacatcctcgacagcgccatgcgcgcgttt
ggagagcccggatcggtagtggccagcagcgagccgtcgtttgccatgattccgatcttc
gcccgcatgaacggcttgcgatacgtaggcatcgccgaacgtgccgatcagcaaccggat
ctggacgcgttgctcgccgcgaacccgcgcattctgtatttgtgctcacccaacaatccc
acaggggctgtgcttgcccgggaattgctggagcgcgcggtacgcgaggcgcccggcgtc
gtgttcctcgatgaagcgtacgccgagtttgcgggcgtatcggcggtggacctggccatg
cgtgtggacaacctgctggtgatccgcacgatgtccaaggcctttggtcttgcggggctg
cgggtgggctatggtatcggcgctcccgcgctggtgcgtgacgtggagaaatcccgcggc
ccgtacaaactcaacgcgatggccgaacagacggcactggccgcattgcagcatgatatg
gcgtgggtgcgtgaacacgtcgcactggccgtgcagaaccgtgagcgcctggctcaggct
ttggtgcagcgcggatatactccgctgccgtcgcacgccaactatctctgtgtgccggtg
tccaatgcggtggccgtcggacaggcgatgcgcgcccgtggagtggctgcgcgtcccttc
ccggcgctaccgcatgtgggcgacacgttgcgcatcagtgtggggccgtggcctttactc
gaacaactgctcaccgcgtttgatgacgccacccaggaggtgaacggatga

DBGET integrated database retrieval system