KEGG   Gemmatimonas aurantiaca: GAU_0165Help
Entry
GAU_0165          CDS       T00878                                 

Definition
putative esterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
gau  Gemmatimonas aurantiaca
Brite
Enzymes [BR:gau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     GAU_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
196264..197121
Genome map
AA seq 285 aa AA seqDB search
MFNLSARRAAIGARFEQADEARRPRDAQGIVRGAEPFLLRGTNDRAVLVLHGFNDTPQSM
RHLAMRINDDGYTVDVPRLPGHGGSLAELARDGHAVNWRRAVREAYDALRRTHSVVHLCG
QSMGGALATLEAHDHAEVRALVLLAPYLGMPFDMRWQTYAAALLAPFTLYHRSKGAERSI
HDPAARAKALGPGIVTPGALAGLRTVALAAHDALPTLTVPTLYLQSREDNRIAAADAERY
FVRIGSAIKKQQWLTGCGHIISADYCRDTVADAAIAWFRRFEGTA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacctgagcgcccgacgggctgcaatcggcgcgcgcttcgagcaagccgacgag
gctcggcgcccgcgtgatgctcagggcatcgtgcgtggtgcggagcctttcctgttgcgg
ggcaccaatgaccgcgcggtactggtgttgcacggattcaatgacacgccacagtcgatg
cgtcatctggcgatgcgcatcaatgacgacggctacacggtggacgtaccgcggctgccg
ggccatggtggatcgttggccgaactggcacgcgacggccatgccgtgaactggcgtcgt
gcggtccgcgaggcatacgacgccctgcgacggacgcacagtgtcgtgcatctctgtgga
cagagcatgggtggtgcactggccacgctcgaagcccatgaccacgcggaggttcgtgcg
ctggtattgctggcaccgtacctcggcatgccgttcgatatgcgctggcagacgtatgcc
gcggcgctgttggcgccgtttacgctgtatcaccgcagcaagggagccgagcgctccatt
cacgacccggcggcccgcgccaaggcgttgggcccgggtatcgtcacgcctggagcgctg
gccggtcttcgcacggtcgcactggcggcgcatgacgcgttgcccacgctgacggtgccc
acgctgtatctgcaatcacgcgaggacaatcgcatcgccgcggccgatgcggagcgctat
ttcgtgcgcattggcagtgcgatcaagaaacagcagtggttgaccggttgtggccacatc
atttcagcagactactgccgggatacggtcgccgatgccgccattgcctggttccggcga
tttgaggggacggcgtga

DBGET integrated database retrieval system