KEGG   Gemmatimonas aurantiaca: GAU_0166Help
Entry
GAU_0166          CDS       T00878                                 

Definition
putative fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GAU_0166
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    GAU_0166
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     GAU_0166
Lipid biosynthesis proteins [BR:gau01004]
 Desaturase
  First
   GAU_0166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
197421..198266
Genome map
AA seq 281 aa AA seqDB search
MPERSVVKMAGPGNPILITVWSCYMPEFGSWGTDWWKPVVFILVAGHLTNICVTLFLHRS
QTHRGVQFHGLVELPMRVWLWLTTAIRTKEWVACHRKHHAFADREGDPHSPVVEGLRNIL
LKGAFFYRKAVRQPGVLEKYGKGTPEDWIERHLLDKRSSVGILVMLAIDIWLFGWFTGPV
VWAVQMIWIPFWAAGVINGIGHALGYRNHDVKDESRNISPIGIIIAGEELHNNHHADPHS
AKFAHRWFEFDIGWMYITLLSFFGLAQVKYARQGTHVRISE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagcggtccgtcgtgaagatggccggtccgggcaacccgatcttgatcaccgtt
tggagttgctacatgcccgagttcggaagctgggggaccgattggtggaagccggtcgtc
ttcatccttgttgccggtcatctcaccaacatctgcgtcaccttgttcctgcaccgctcg
cagacccatcgcggggtgcagttccatgggttggtcgaactgccgatgcgtgtctggctg
tggctgacgacagcgatccggaccaaggagtgggtggcctgtcatcggaagcatcatgcg
tttgccgaccgggaaggcgatccgcatagcccggtggtggaaggactgcgcaatattctg
ctcaagggcgcgttcttctatcgcaaggcggtacgtcagccgggagtgctcgagaagtac
ggcaagggcacgcctgaggattggatcgaacggcacctgctcgacaagcgttccagtgtc
ggcattctggtcatgctggccatcgacatctggctgttcggctggttcaccggccccgtc
gtctgggccgtgcagatgatctggatcccgttctgggctgcgggcgtcatcaacggcatc
ggccacgcgctgggctaccgcaatcacgacgtgaaggacgaaagccgcaacatctccccg
atcggcatcatcattgccggtgaggagttgcacaacaaccaccacgccgatccgcactcg
gccaagttcgcgcaccgctggttcgaattcgacatcggctggatgtacatcacgctgctg
tcgttcttcggtctcgcgcaggtgaagtacgcgcggcagggcacccacgtgcggatctcg
gagtaa

DBGET integrated database retrieval system