KEGG   Gemmatimonas aurantiaca: GAU_0540Help
Entry
GAU_0540          CDS       T00878                                 

Definition
(GenBank) peptidase M42 family protein
Organism
gau  Gemmatimonas aurantiaca
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
Position
complement(628675..629754)
Genome map
AA seq 359 aa AA seqDB search
MLSDSSIAFLKRLLDTPGPSGFEGAPARAWRTEAATFTSAIRADVIGNSYAVVEGTGGPN
APTILLAGHIDEIGVIITHIDDNGYIYFEPIGGWDPQVLVAQRMRFLGRNGDVFGVIGKK
AIHLMKPEEREKASKITDLWVDIGVKNKAEAQELLQVGDAGVIDSRTMDMPNHRIVSRSI
DDRIGAFVVLEALRRYAENPGHARVVAAATAQEEIGYTGGGARVAAHSQEATMAIAVDVT
FATDHPGVKKEEIGEHNIGGGPVLTRGSVISPVVYRLLSETAQRLEIPFSIHAAGRFTST
DADAMQLARSGVATGLVSIPNRYMHSPNEMVSLEDLDRAATLIAETCRTVSDATDFTDR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgctctccgactcctccatcgcatttctcaagcgcctgctcgacacccccggaccgtcg
ggcttcgaaggcgcaccggcgcgcgcctggcgcaccgaagcggccacgttcacgtcggcc
atccgcgccgacgtcatcggcaattcgtacgccgtggtcgaaggcaccggtggcccgaac
gcgccgacgattctgctggccggtcatatcgacgaaatcggtgtgatcatcacccacatc
gacgacaacgggtacatctacttcgaaccgatcggcggctgggatccgcaggtgctggtg
gcccagcgtatgcgctttctgggtcgaaatggggatgtgttcggtgtgatcggcaagaag
gccatccacctgatgaaacccgaggaacgcgaaaaggcgtccaagatcaccgatctgtgg
gtcgacatcggcgtgaagaacaaggccgaggcgcaggaactgctgcaggtgggtgatgcc
ggcgtgatcgattcccgcacgatggacatgcccaatcaccggatcgtgtcgcgcagcatc
gacgaccgcatcggggcgttcgtcgtgctcgaggcgctgcggcgctatgcagaaaatccg
gggcatgcccgcgtggtggcggccgcgacggcgcaggaagagatcggctacacgggtggc
ggcgcacgggtggcggcgcattcgcaggaggccaccatggcgatcgcggtggacgtgaca
ttcgcgaccgaccatcccggtgtgaagaaggaagaaatcggtgagcacaacatcggcggt
ggaccggtgctgacacgcgggtcggtgatttcgccggtggtgtatcgcctgctgtcggag
acggcgcagcgactggagatcccgttctcgatccatgccgccggtcgtttcacgagcacc
gacgccgacgcgatgcaactcgcacgcagcggtgtggcgacgggcctggtgtcgattccg
aaccgctacatgcactcgccgaacgagatggtttcgctggaggacctcgatcgggccgcc
acgctcatcgcggaaacctgccgcacggtgagcgacgccaccgatttcaccgaccgatag

DBGET integrated database retrieval system