KEGG   Gemmatimonas aurantiaca: GAU_0748Help
Entry
GAU_0748          CDS       T00878                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gau  Gemmatimonas aurantiaca
Pathway
gau00010  Glycolysis / Gluconeogenesis
gau00020  Citrate cycle (TCA cycle)
gau00620  Pyruvate metabolism
gau01100  Metabolic pathways
gau01110  Biosynthesis of secondary metabolites
gau01120  Microbial metabolism in diverse environments
gau01130  Biosynthesis of antibiotics
gau01200  Carbon metabolism
Module
gau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GAU_0748 (pdhC)
   00020 Citrate cycle (TCA cycle)
    GAU_0748 (pdhC)
   00620 Pyruvate metabolism
    GAU_0748 (pdhC)
Enzymes [BR:gau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GAU_0748 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: BAH37790
NITE: GAU_0748
UniProt: C1A6D0
Position
complement(898593..899918)
Genome map
AA seq 441 aa AA seqDB search
MATKVMMEALSPTMEEGRLVKWVKNVGDAVKSGDTLAEVETDKAIMELVARGDGILRARL
VEEGTTSPIGATIGVIAAADEDISALTSGGGAAAPAAAAPAPTAAAAPAAEAPAAPAAAP
ATPAPATPAAPVAAAAEAAGPVRSSPLARRLAAERGLSLSAIQGSGPNGRVIRRDIEAAG
STAASTAAAPAAASAAPSASTKPTAAAAPAIQIEGEYKDVALTQMRKTIARRLGESIGPV
PTFYLTSEIDMTNVVKLREQMVAAGDAFKVSINDIIIKAVAVALTRHPECNAHWMGDHIR
YFAAAHVGMAVATDDGLIVPVIRDAHTKGLGQIGRDARELAKKARERKLTPAEYSGGTFS
VSNLGMFGIDQFTAIINPPEAAILAVGSTETKPIWDGNAFVPRQRMRVTMSCDHRIIDGA
VGARFLQTFKQLLESPLLMVF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaaaagtgatgatggaggcgctctctcccacgatggaagaagggcgcctggtg
aagtgggtcaagaacgtcggtgatgccgtgaagtccggcgacacgttggccgaagtcgaa
accgacaaggccatcatggagctcgtcgcgcgcggcgacggcatcctgcgtgcccgtctc
gtcgaagagggcaccaccagccccattggtgccacgatcggtgtcatcgccgctgccgac
gaagacatcagtgcgctgaccagtggtggtggtgcagcagcgcctgcggccgccgcaccg
gctccaacggccgcggcagcgcccgccgccgaagctccggccgccccagcggcggccccg
gctacgcccgctcccgcaacaccggcagctccggtggcggcggcagcagaagccgccggt
ccggtgcggtcctcgccgctcgcccgccgactggcggccgagcggggactcagcctgtct
gccattcagggttccggcccgaatggtcgcgtcattcgtcgcgacatcgaggccgcgggc
agcacagcggccagcacggccgccgcacccgctgccgccagtgcggcgccgagtgcgtcc
accaagcccaccgcggccgcggcacctgccatccagatcgagggcgaatacaaggacgtc
gcgctcacccagatgcggaagacgatcgcccgtcgcctcggcgaatcgatcggccccgta
cccacgttctatctcacgtcggaaatcgacatgacgaacgtggtgaagttgcgcgaacag
atggtggccgccggcgatgcgttcaaggtgtcgatcaacgacatcatcatcaaagccgtc
gccgtcgcactcacgcgccatccggagtgcaatgcccattggatgggggatcacatccgt
tatttcgcggccgcgcacgtcggtatggccgtggcgacggatgatgggctgatcgtgccg
gtcatccgcgatgcacacaccaagggactcggacagatcgggcgggacgcccgcgagctg
gccaagaaggcccgtgagcgcaaactgacgccggccgaatactcgggcgggacattctcg
gtttccaacctgggcatgttcggtatcgaccagttcaccgcgatcatcaatccgcccgag
gctgccatcctcgcggtgggctctaccgagaccaagccgatctgggacggtaacgccttc
gtaccacgtcagcgcatgcgcgtgacgatgagctgtgaccatcgaatcattgacggcgcg
gtcggcgcgcggttccttcagacgttcaagcagttgctggaatcgccgctgctgatggtc
ttctga

DBGET integrated database retrieval system