KEGG   Gemmatimonas aurantiaca: GAU_0780Help
Entry
GAU_0780          CDS       T00878                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:gau00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
937627..938295
Genome map
AA seq 222 aa AA seqDB search
MSTTRENEHVMRRELNVGGGAHGADPDELPMAGERSSEYETMVRRQLELIGEDPTRDGLL
KTPGRVARSMAWLTRGYDLDPRSVIGDALFAEDHENMVMVRDIEMYSMCEHHMLPFFGKV
HIAYIPNGKIVGLSKLPRVVEVFARRLQVQERLGEQIANAIVDVLQPKGVGVVIEAVHLC
MMMRGVEKQNSRTITSSLRGLFRDDAKTRSEFLRLAYATPGF
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactactcgggagaatgagcacgtgatgcgacgtgaactcaacgtgggtggtggt
gcacatggcgccgatccggacgaattgccgatggcgggcgaacggtcgtccgagtacgag
acgatggtccgccggcaactcgagctgatcggcgaagatccgacacgggatggcctgctc
aagacaccggggcgggtggcacgctccatggcatggttgacccgcggttacgacctcgat
ccacgcagcgtcatcggcgacgcactgttcgccgaagaccatgaaaacatggtgatggtc
cgtgacatcgagatgtactccatgtgtgaacaccacatgctgccgttttttggcaaggtg
cacatcgcctacatcccgaacggcaagattgtcggcttgagcaagctgccacgcgtggtg
gaggtgtttgcccgtcgcctgcaggtgcaggagcgtctgggcgagcagattgcgaacgcc
atcgtcgacgtgctgcagccgaagggtgtgggtgtggtcatcgaggcggtgcacctgtgc
atgatgatgcgcggcgtggagaagcaaaattcgcgcaccatcacgtcgtcactgcgtgga
ctgttccgtgatgatgcgaagacccgcagtgagtttctgcggctcgcctacgccacgccc
ggcttctga

DBGET integrated database retrieval system