KEGG   Gemmatimonas aurantiaca: GAU_1006Help
Entry
GAU_1006          CDS       T00878                                 

Definition
putative vitamin B12 transport periplasmic protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:gau00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:gau00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1184624..1185070
Genome map
AA seq 148 aa AA seqDB search
MSRFDGQVVLLVNVASQCGFTPQYEGLERLWRRFGDRGLVILGCPCDQFGAQEPGDEAEI
ARFCSLTYDVTFPLSSKLDVNGDAADPLWQWVKAEEPGVLGTTSVKWNFTKFLIGRDGTV
LERFAPTVTPDELVAPVEQALAAPPVAG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggttcgatgggcaggtggttttgctggtcaacgtcgccagccagtgcggcttc
acgccgcagtacgaggggctggagcgcctgtggcgacgcttcggtgaccgtgggctcgtg
atcctcggctgcccctgcgatcagttcggggcgcaggagccgggcgacgaagcggagatc
gcccgcttctgctcactcacctacgacgtgacattcccgctgtcgtccaagctggacgtg
aacggcgatgcggccgacccgctctggcagtgggtgaaagctgaggagcctggggtgttg
ggtacgacgtcggtcaagtggaacttcaccaagttcctgatcggtcgcgatgggacggtg
ctggaacgcttcgcgccgacggtgacacctgatgaactggtggcaccggtggaacaggcg
ctcgctgctccaccggtcgctgggtag

DBGET integrated database retrieval system