KEGG   Gemmatimonas aurantiaca: GAU_1006Help
Entry
GAU_1006          CDS       T00878                                 

Definition
putative vitamin B12 transport periplasmic protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GAU_1006
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GAU_1006
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GAU_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1184624..1185070
Genome map
AA seq 148 aa AA seqDB search
MSRFDGQVVLLVNVASQCGFTPQYEGLERLWRRFGDRGLVILGCPCDQFGAQEPGDEAEI
ARFCSLTYDVTFPLSSKLDVNGDAADPLWQWVKAEEPGVLGTTSVKWNFTKFLIGRDGTV
LERFAPTVTPDELVAPVEQALAAPPVAG
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggttcgatgggcaggtggttttgctggtcaacgtcgccagccagtgcggcttc
acgccgcagtacgaggggctggagcgcctgtggcgacgcttcggtgaccgtgggctcgtg
atcctcggctgcccctgcgatcagttcggggcgcaggagccgggcgacgaagcggagatc
gcccgcttctgctcactcacctacgacgtgacattcccgctgtcgtccaagctggacgtg
aacggcgatgcggccgacccgctctggcagtgggtgaaagctgaggagcctggggtgttg
ggtacgacgtcggtcaagtggaacttcaccaagttcctgatcggtcgcgatgggacggtg
ctggaacgcttcgcgccgacggtgacacctgatgaactggtggcaccggtggaacaggcg
ctcgctgctccaccggtcgctgggtag

DBGET integrated database retrieval system