KEGG   Gemmatimonas aurantiaca: GAU_1114Help
Entry
GAU_1114          CDS       T00878                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
gau  Gemmatimonas aurantiaca
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:gau03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1327116..1327715
Genome map
AA seq 199 aa AA seqDB search
MSVIDELTNELARLPGIGRKTALRLTYHLLRQPASQCRNLADALVALTERVRSCERCHNL
TESTLCHLCADPRRDAATLCVVEQASDIASIERAGEFRGLYHVLGGRLSPLDGVGPDDLH
VADLLARLEAEGVREVILATNPSLEGEATALYVQRQLAGSASSHAIRVTRIARGLPVGGD
LEYADGVTIAQAIAARREM
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcatcgacgaactcacgaacgaactggcgcgtctgccgggcattggtcggaag
accgccctacggctgacgtatcatttgctgcggcagccggcgtcccaatgccggaatctg
gcggacgcattggtggcactcaccgagcgtgtgcgtagctgtgagcggtgccacaacctc
accgagtccaccctgtgccatctgtgcgccgatccgcgccgggatgcggccacgctctgt
gtggtggaacaggccagtgacattgcgtccatcgagcgggccggggaattccggggtctg
taccacgtgctgggcgggcgcctgtcgccattggatggcgtaggcccggacgacctgcat
gtggcggacctgctggctcgcctcgaggccgagggggtacgggaagtgatcctggccacc
aacccctcgctggaaggggaggccacggcgctctatgtgcagcgtcaactggcaggctct
gcgtcgagccatgcgatccgggtgacccggatcgcccgcgggttgcccgtgggcggagac
cttgaatatgccgatggtgtgacgatcgcccaggcgatcgcggcccggcgggagatgtga

DBGET integrated database retrieval system