KEGG   Gemmatimonas aurantiaca: GAU_1368Help
Entry
GAU_1368          CDS       T00878                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GAU_1368 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GAU_1368 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GAU_1368 (thrC)
Enzymes [BR:gau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GAU_1368 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1644325..1645662
Genome map
AA seq 445 aa AA seqDB search
MSANDAIFLSAHEAPGAQSIQRCDACAHELTALDAAPECPKCGGLLAIIHRAPVDVMGAP
LVGSALAQCLSPATPGVHVSGVWRFESLIMPGAGEAITSHPEGNTPLMARTRVNAFAGCD
GLLLKHEGYNPTGSFKDRGMTVGTTQAVRTGATAVACASTGNTSAALASYAAQAGIPGLV
FVPAGKVALGKMAQTLAYGATTLLVRGDFDACLKLVQEASRELGIYLLNSINPWRVEGQK
TIVFEMLQQLEWNAPDFIVLPAGNLGNTAAFGKALREAQALGLITRVPRIVSVQAAGAAP
FAHGFRNGFATRQAVQAETIATAIRIGDPASWDRAVRAIRETDGLVITVTDDEIIDAKVV
IDASGVGCEPASAASVAGVRQLVQSGVIKASDRVVAVLTGHVLKDPGILVELHQERADFA
AANRPVEIEPTVQAVADILRRSRAN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagtgccaacgacgcgatctttctttcggcgcacgaggcgcccggcgcacagagcatt
cagcgatgtgatgcctgtgcccacgagctgaccgcactggacgcggcaccggagtgcccg
aagtgtgggggactgttggccatcatccatcgcgcgccggtcgatgtcatgggtgcgccg
ctggtgggatcggcgttggcacagtgcctgagccccgccacacccggcgtgcatgtttcg
ggcgtgtggcgttttgaatcgctcatcatgcccggcgctggtgaggccatcacgagtcat
ccggaaggcaacaccccattgatggcgcgcacgcgggtgaatgcgtttgccggttgtgat
gggctgttgctcaagcacgaaggctacaatcccacgggttcgttcaaggaccgcggcatg
acggtgggcaccacccaggcggtgcgcacgggtgccacagcggtggcctgtgcatccact
ggcaacacgtcggcggcattggcgtcgtatgcggcgcaggccggtattccggggctggtg
tttgtgccggccggcaaggtggccctgggcaagatggcgcagacgctggcctacggcgcc
accacgctgctggtgcgcggggatttcgacgcttgcctcaagctggtgcaggaagcgtca
cgtgagttgggcatctatctgctcaactccatcaatccgtggcgcgtggaaggccagaag
acgatcgtcttcgaaatgctgcagcagctcgaatggaacgcgcccgatttcatcgtgttg
ccggccggcaatcttggcaacacggccgccttcggcaaagcactgcgtgaagcgcaggcg
ttggggctcatcacgcgcgtgccacgcatcgtgtcggtgcaggcggcgggcgcggctcca
tttgcccacggcttccgcaacgggttcgccacgcgtcaggcggtgcaggccgaaacgatt
gccacggccattcgcatcggcgatccggccagttgggatcgtgcggtacgtgccattcgt
gagaccgatggcctggtcatcaccgtgacggacgatgagatcatcgacgccaaggtggtc
atcgatgcctcgggcgtgggctgtgagccggccagcgcggcgagcgtggccggtgtgcgg
cagctcgtgcagtctggcgtgatcaaggcgagtgatcgcgtggtcgccgtgctcaccggt
cacgtgctcaaggacccgggcattcttgtggaactgcaccaggagcgcgcagactttgcg
gcagccaatcgtccggtggagatcgaaccgacggtgcaggccgtggctgatatcctgcgt
cgttcccgcgcgaactga

DBGET integrated database retrieval system