KEGG   Gemmatimonas aurantiaca: GAU_1385Help
Entry
GAU_1385          CDS       T00878                                 

Gene name
nosZ
Definition
putative nitrous oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    GAU_1385 (nosZ)
Enzymes [BR:gau01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     GAU_1385 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1663176..1665290)
Genome map
AA seq 704 aa AA seqDB search
MHLQFRRGSATMSLSHRTGWFIATATVAATLAYGYACTPATKSPGAIGASDAASKVYVAP
GAHDEFYAFLSGGFNGQVGVYGLPSGRLLKIIPVFSQFAENGYGYSEETKPMLETTFGNI
PWDDLHHTALSQTNGEDDGRWLFVNANNTPRVARVDLSTFETSEILQIPNSGGNHGSPYI
TSNSEYVLASTRFSVPIPQADVPISDFAKKFKGTISFVKADQPGKMDVSFQLLVPGYNYD
LARAGKGPSKDWVFFTSYNSEQAYEKLEVNASKADKDFIAAINWRTLETCAKDGKAENWP
ADYMHNVMDEFTRTAQVERKQSVKVLTPTTCPNSIYFLPTPKSPHGADVDPSGEYIVAGG
KLATVIPVHSFTKLQQAIKDQAFETTIEGIPVLKYEAILAGEVKDPGLGPLHTEFDGKGY
AYTSLFISSEIVKWKLGTWEIVDRVPTYYSIGHLMIPGGATTKPAGKYVVALNKITKDRY
LPTGPELTQSAQLYDISGDKMKLLLDFPTTGEPHYGNAIEAAKIEKLQKKFFTLAENRHP
QVTKAEREAGVSRNGKVVHVRMAAIRSHFAPDNIEGVQVGDTVLFHVTNLEQDWDIPHGF
AIQGATTSELLVMPGETRTLRWVPKQIGVYPMYCTDFCSALHQEMSGYVRVSPVGSNVPL
VGNTLKAQGQAARAAARGVTLPTPPGAVTGAAHAHGTAPSPTPR
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgcacctccaattccggcggggatccgcaaccatgtctctttctcaccgcaccgggtgg
tttatcgcgacggccacggtggccgcgacactcgcttacggctatgcgtgcacaccggcc
accaagtcgccaggtgccattggcgcgagtgatgccgccagcaaggtgtacgtcgcgcca
ggcgctcacgacgagttctacgcatttctctccggcggcttcaacggtcaggtcggtgtg
tacggcctgccctccggtcgcctgctgaagatcatcccggtgttctcccagttcgccgaa
aacggctacggctattcggaagaaacgaagccgatgctggagaccaccttcggcaacatc
ccgtgggacgacctccaccacaccgctctctcgcagaccaacggcgaagatgacgggcgt
tggttgttcgtgaacgccaacaacacgccgcgcgtggcccgtgtggacctctcgacgttc
gagacatcggagatcctgcagatcccgaactcgggtggcaatcacggttcgccctacatc
acgtcgaacagcgagtacgtgctggcgtcgacgcgtttctcggtaccgattccgcaggcc
gatgtaccgatcagcgatttcgccaagaagttcaaaggcacgatctccttcgtgaaggcc
gaccagccgggcaagatggacgtgtcgttccaactgctcgtgccgggctacaactacgac
ctggcccgcgcgggcaagggcccgtcgaaggactgggtgttcttcacgtcgtacaactcg
gagcaggcgtacgagaagctggaagtgaacgcgtcgaaagccgacaaggatttcatcgcg
gcgatcaactggcgtaccctcgaaacgtgtgcgaaggacggcaaggccgaaaactggccg
gccgactacatgcacaacgtgatggacgagttcacgcgcaccgcccaggtggaacgcaag
cagtcggtgaaggtgctcacgcccaccacctgccccaactcgatctacttcctgccgacc
ccgaagtcgccgcacggcgccgatgtggatccgtcgggtgaatacatcgtcgccggtggc
aaactggccacggtcattccggtgcattcgttcacgaagctgcagcaggccatcaaggat
caggcgttcgaaacgaccatcgaaggcatcccggtgctcaagtacgaagccatcctggcc
ggcgaagtgaaggatcctggcctcggccccctgcacaccgagttcgatggcaagggctac
gcctacacgtcgctgttcatctccagcgagatcgtgaagtggaagctgggtacgtgggag
atcgtcgatcgggtgccgacgtactactcgatcggtcacctgatgattcccggcggcgcc
accaccaagccggcgggcaagtatgtcgtcgcgctcaacaagatcacgaaggatcggtac
ctgcccacgggtccggagctcacgcagtcggcgcagctctacgacatctcgggcgacaag
atgaagctgctgctcgacttcccgaccacgggcgaaccgcactacggcaacgcgatcgaa
gccgcgaagatcgaaaagctgcagaagaagttcttcacgctggccgagaaccggcatccg
caggtgacgaaggccgaacgtgaagcgggtgtgagccggaacggcaaggtggtgcacgtg
cgcatggcagccatccgttcgcacttcgcccccgacaacatcgaaggagtgcaggtgggt
gacacggtgctcttccacgtcaccaacctcgagcaggactgggacatcccgcatggcttt
gcgatccagggtgccaccacttcggagttgctggtgatgccgggtgaaacccgcacgttg
cgctgggtgccgaagcagatcggcgtgtatccgatgtactgcaccgacttctgctcggcg
ctgcaccaggaaatgtccggctacgtgcgcgtctccccggtgggttcgaacgttccgctg
gtaggcaacacgctgaaggcgcaggggcaggcggcacgggctgccgcacgcggtgtgacg
ctgccaactccgccgggcgcagtgacgggcgccgcgcatgcgcacggcaccgcaccgtcg
cccactccgcgctga

DBGET integrated database retrieval system