KEGG   Gemmatimonas aurantiaca: GAU_1517Help
Entry
GAU_1517          CDS       T00878                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    GAU_1517
Enzymes [BR:gau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     GAU_1517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1824119..1824862
Genome map
AA seq 247 aa AA seqDB search
MSTVTGLLAEIVEQAEALALACRRLHAGGLLAGAEGNLSVRLSDSTILITASGVDKARIH
AGQVVRVHADGAPHHEPESMGRMCDGTDTPRGDSPVRASSELGMHVACYAARPDVRGIVH
AHPPVATGFAVAGLSLPADVLPEVPVIVGPVALVPYGRPGTPALAAVLEPFFAAHEVFLL
ANHGVTAVGRSLTDALLRMESVEQAARIVAVARLLGGEQRLPAGEAAALASLRRSRELPS
EPSSRSL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgtcacggggctgctggcagaaatcgtcgaacaggccgaggctcttgccttg
gcctgtcgtcgtctgcatgccggcggattgctggcaggtgcggagggcaacctctccgtg
cggctgtcggatagcacgatactcatcacggcatccggcgtggacaaggcgcgcatccat
gccggtcaggtggtgcgggtgcacgccgatggcgcgccgcatcacgagccggagagcatg
ggccggatgtgtgacggtaccgacacaccacggggtgacagtccggtccgcgcctcgtcg
gagttggggatgcatgtggcgtgttacgccgcgcgaccggatgtgcgcggcatcgtgcac
gcccatccaccggtggccacggggtttgccgtggcgggtctttcgctgcccgccgatgta
ctaccggaggtgccggtgattgtgggaccggtggccctggtaccgtacggacgcccgggc
acccccgcactcgccgctgttctggaaccgttttttgccgcgcatgaggtgtttctgttg
gccaatcatggtgtgaccgcagtggggcgctcgctcaccgacgcattgctgcgcatggag
agcgtggagcaggccgcacgtatcgtggcagtggcccgcctgctgggaggagagcagcgg
ctcccggccggtgaggccgccgcgcttgcctcgcttcgccgttcgcgtgagcttccctct
gagccttcctcccgatccctatga

DBGET integrated database retrieval system