KEGG   Gemmatimonas aurantiaca: GAU_1599Help
Entry
GAU_1599          CDS       T00878                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    GAU_1599
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GAU_1599
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    GAU_1599
Enzymes [BR:gau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     GAU_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1918741..1919886
Genome map
AA seq 381 aa AA seqDB search
MSAPTWSLQCSACGTSASVENASVCQACHQPLFATYDPVAAGTPLGSRWDMWRYAPFLPL
LEGEIPVSLGEGLTPLIESPTLAAAVGVRRLWIKDEAQNPTGSFKARGMSAAVTRARAAR
VPGLVVPTAGNAGAALAAYGAAAGVPVRVYAPATTPRPILDTIEVMGAELIRIDGHIGDA
GKLALAFAAESGYVPISTLREPYRVEGMKTMGFELVEQLGWRVPDVVVYPTGGGEGTVGI
WKAINELVSSGWLPGETRQPRYLVAQAEGCAPIARAFAAGTEKADPWVDPVTHAAGLRVP
SPLGDRLLLRVMRETDGLAGTASEDAIREWTRTLAVKTGIDAAPEGGCGLSVLRDAVASG
AVQGDAEVVLFNTGSGASYRV
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctcccacctggtcgctgcagtgttcggcgtgcggtacatcggcatcggtcgag
aatgcctcggtgtgtcaggcgtgccatcagccgctgttcgcgacatacgatcccgtggcc
gctggcacgccactggggagccggtgggatatgtggcgctatgctccgtttctgccgctg
ctcgaaggggaaatcccggtgagtctgggagaggggcttacgccgctcatcgaatcaccg
acgttggcggcggccgtcggtgtccggcgcctgtggatcaaggacgaagcccagaatccg
acgggctcattcaaggcgcgcggcatgagtgcggccgtcacgcgtgcacgggccgcgcgg
gtgcccggtctcgtggtgccgaccgcgggcaacgccggcgcggcactggcggcctacggt
gcggccgccggtgtgccggtgcgcgtgtacgcgccggccaccacaccgcgcccgattctc
gataccatcgaagtgatgggcgcagagctcatccggatcgacggacacatcggtgatgct
ggcaagctggcgctcgcgttcgcggccgaatcgggctacgtgccgatttccacactccgg
gagccgtaccgcgttgaaggcatgaagacgatgggcttcgagctggtggagcaactcggc
tggcgtgtgccggatgtggtggtctatccaaccggtggtggtgaaggcaccgtcggtatc
tggaaggcgatcaacgaactggtgtccagcggctggctaccgggcgaaacccggcaaccg
cgctacctggtggcgcaggcggaaggatgtgcgcccattgcccgcgcttttgccgccggc
acggagaaggccgatccgtgggtggatccggtgactcatgccgcagggctgcgggtgcct
tcgccgttgggcgatcggttgctgctgcgggtcatgcgagagaccgatggtttggcggga
accgcatccgaagatgccattcgtgagtggacacgcacgttggccgtgaagacgggcatc
gatgctgcgcctgagggcgggtgcgggctttccgtactgcgcgatgcggtggccagcggc
gcggtgcagggcgacgccgaagtggtgctgttcaacaccggcagcggggcgtcgtaccgg
gtctga

DBGET integrated database retrieval system