KEGG   Gemmatimonas aurantiaca: GAU_1606Help
Entry
GAU_1606          CDS       T00878                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
gau  Gemmatimonas aurantiaca
Brite
Enzymes [BR:gau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GAU_1606 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1925467..1926126
Genome map
AA seq 219 aa AA seqDB search
MVAGAVEPEFRGARRRLVEALQDKGIKDLALLRAVDAIPRHLFVPPTVRHRAYEDSALPI
GNGQTISQPYVHARSVEQLLLTGTERVLEIGTGSGYQTALLSHLAAQVFSVERYRELLDR
ARPILQQANVRNASLSLGDGTLGWREYAPYDGIVVSAGAPHVPPALEEQLAEGGRLLIPV
GSKEEQMLTVFIKRGGRLEGRDITPVRFVPLIGAGGWPG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaggagccgtagagccggaattccgcggggcgcgtcgtcgtctggtggaagcc
ctgcaggacaaggggatcaaggatctcgcactcctgcgggcggtggatgcgatcccgcgt
cacctgttcgtaccgcccacggtgcggcatcgcgcgtacgaggactcggcgctgccgatc
gggaacgggcagaccatctcgcagccctatgtgcatgcgcgatcggtggagcaattgctg
ctgaccggcaccgagcgggtgctcgagatcgggaccggctccggctaccagacggcgttg
ttgtcccatctggcggcgcaggtgttttcggtggagcgatatcgcgaactgctcgatcgg
gcgcggccaattctccagcaagccaacgtgcgtaacgcctcgttgtctctgggcgacggc
acgctgggctggcgggagtatgcgccgtacgatggaatcgtcgtcagcgccggtgcgccg
catgtgcctccggcgttggaggagcagctcgccgaaggggggcgattgctgatccccgtg
ggcagcaaggaagagcagatgctgaccgtgttcatcaagcgcgggggccgactcgagggc
cgtgacatcacgccggtccgattcgtccccttgattggggccggaggctggccgggctga

DBGET integrated database retrieval system