KEGG   Gemmatimonas aurantiaca: GAU_1646Help
Entry
GAU_1646          CDS       T00878                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase beta chain (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
gau  Gemmatimonas aurantiaca
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:gau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GAU_1646 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GAU_1646 (sucC)
   00640 Propanoate metabolism
    GAU_1646 (sucC)
   00660 C5-Branched dibasic acid metabolism
    GAU_1646 (sucC)
Enzymes [BR:gau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GAU_1646 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1964983..1966128)
Genome map
AA seq 381 aa AA seqDB search
MNLHEYQAKELLRVAGVPIPPGEIATTPEQAEAIAKKLGTAVMVKAQVHAGGRGKAGGVK
FCPTPEAAKEKATAILGMTIKDLTVEKVLVTVAADIASEAYVGIIVDRATKKPVFMVSAA
GGIDIEEVAATTPEKILYHPVDTRYGLLPFEAMRMGFFLYQDVKLARQAAKIMQQLYTAF
MSAGCSIAEINPLVVTPQNELIAVDGKMVIDDNELDRLPQIAALRDESSEAPSEVDARNA
NLTFIKLDGNVGCVVNGAGLAMATMDLVKYYGGDPANFLDIGGSSNPEKVVNALRIITAD
PNVKCILFNIFGGITRTDDVANGIVTATKANPLKVPIVIRLTGTNEELALQILKENGFSA
SSDMDSAVQRAVELATKGGAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaacctacacgagtatcaggcgaaggagctgctgcgggtggccggtgtgccgatcccg
ccaggtgaaatcgccacgacgccggagcaggcggaggccattgcgaaaaagcttggcacc
gccgtgatggtaaaggcccaggtccatgccggcggtcgcggcaaggccggtggcgtgaag
ttctgcccgacgcccgaagcggcgaaggaaaaggccacggccatcctcggcatgaccatc
aaggacctgaccgtcgagaaggtcctcgtcacggtggccgctgacatcgcgtcggaagcc
tacgtcggcatcatcgtggatcgtgccacgaagaagccggtgttcatggtctccgccgct
ggtggcatcgacatcgaagaggtggcagccaccacgccggaaaagatcctctaccacccg
gtggacacgcgctacggcctgttgccgttcgaagccatgcgcatgggcttcttcctgtat
caggatgtgaagctggcgcgccaggccgcgaagatcatgcagcagctctacacggcgttc
atgagcgccggctgctcgatcgccgagatcaacccgctcgtcgtgacgccgcagaatgaa
ctcatcgcggtcgacggcaagatggtcatcgacgacaacgaactcgatcgcctcccgcag
atcgccgcactgcgcgacgaatcgtcggaagcgccgagtgaagtcgatgcgcgcaacgcg
aacctcacgttcatcaagctcgatggcaacgtcggctgcgtggtgaacggcgccggtctc
gcgatggccacgatggatctcgtgaagtactacggcggcgacccggccaacttcctcgac
atcggcggctcgtcgaacccggagaaggtcgtgaatgcactgcgcatcatcaccgccgat
ccgaacgtcaagtgtatcctgttcaacatcttcggcggcatcacgcgcaccgatgacgta
gccaacggcatcgtcacggccacgaaggcgaatccgctcaaggtgcccatcgtcatccgc
ctcactggcaccaacgaggagctcgcgttgcagatcctgaaggagaatggcttctccgcg
tcgagcgacatggactcggccgtgcagcgtgccgtggaactcgccaccaagggaggtgcc
gcgtga

DBGET integrated database retrieval system